Dataset for protein Bim of organism Ornithorhynchus anatinus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************                                    
MAKQPSDLNSECDSEGGRLEPAEGPAQPPQLRPGAPTSIRTQYQ------------------------------------
                                            gnlsgggescsqgpfppsssprpfatrsplfifvrr
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                              **********************************
----------------drspppvscdkstqtpsphcqafnhylsamASIRQPQSVPEDMRPEIWIAQELRRIGDEFNASY
ssllsrsssgyfsfdt------------------------------                                  
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****                 :  ..                                                      
CPRR---------------gmldvrpg-vrrgnpstppvtlrppprwrt-------------------------------
    tgmtgglvfmgrlls-lfankserkqpplgfcaerdeheknffgmavtvswrsedprvftsssaeqtravvaspiy
                   e-     dllgl in  l g tl h gpd                                
                   d                                                            

       250
....:....|
          
----------
nyaidtvphg
          
          
© 1998-2021Legal notice