Dataset for protein Bim of organism Ornithorhynchus anatinus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************                                    
MAKQPSDLNSECDSEGGRLEPAEGPAQPPQLRPGAPTSIRTQYQ------------------------------------
                                            gnlsgggescsqgpfppsssprpfatrsplfifvrr
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                              **********************************
----------------drspppvscdkstqtpsphcqafnhylsamASIRQPQSVPEDMRPEIWIAQELRRIGDEFNASY
ssllsrsssgyfsfdt------------------------------                                  
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****                   :  .       .                               *       .     
CPRR-----------------glvrpk-vgrgqps-------------------------------Tssstertrnvvgt
    tgmtgglvfmgrllsemfaldnelsrlklnpngfcapvtlhppprwrtavtvswrsedprvf peratqekaffas
                   d ld   d l   i                                  lpgd lphpgpdm

       250   
....:....|...
             
-------------
piynyaidtvphg
             
© 1998-2020Legal notice