Dataset for protein Bim of organism Ornithorhynchus anatinus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A6I8NCK5_BCL2L11      MAKQPSDLNSECDSEGGRLEPAEGPAQPPQLRPGAPTSIRTQYQGNLSGG
A0A6I8NCK5_BCL2L11      MAKQPSDLNSECDSEGGRLEPAEGPAQPPQLRPGAPTSIRTQYQ------
A0A6I8NCK5_BCL2L11      MAKQPSDLNSECDSEGGRLEPAEGPAQPPQLRPGAPTSIRTQYQ------
A0A6I8NCK5_BCL2L11      MAKQPSDLNSECDSEGGRLEPAEGPAQPPQLRPGAPTSIRTQYQ------
A0A6I8NCK5_BCL2L11      MAKQPSDLNSECDSEGGRLEPAEGPAQPPQLRPGAPTSIRTQYQ------
                        ********************************************      

A0A6I8NCK5_BCL2L11      GESCSQGPFPPSSSPRPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSP
A0A6I8NCK5_BCL2L11      --------------------------------------------------
A0A6I8NCK5_BCL2L11      ----------------------------------------------DRSP
A0A6I8NCK5_BCL2L11      ----------------------------------------------DRSP
A0A6I8NCK5_BCL2L11      ----------------------------------------------DRSP
                                                                          

A0A6I8NCK5_BCL2L11      PPVSCDKSTQTPSPHCQAFNHYLSAMASIRQPQSVPEDMRPEIWIAQELR
A0A6I8NCK5_BCL2L11      --------------------------ASIRQPQSVPEDMRPEIWIAQELR
A0A6I8NCK5_BCL2L11      PPVSCDKSTQTPSPHCQAFNHYLSAMASIRQPQSVPEDMRPEIWIAQELR
A0A6I8NCK5_BCL2L11      PPVSCDKSTQTPSPHCQAFNHYLSAMASIRQPQSVPEDMRPEIWIAQELR
A0A6I8NCK5_BCL2L11      PPVSCDKSTQTPSPHCQAFNHYLSAMASIRQPQSVPEDMRPEIWIAQELR
                                                  ************************

A0A6I8NCK5_BCL2L11      RIGDEFNASYCPRR-----------------FAVRPE-VRRGLPSTPERT
A0A6I8NCK5_BCL2L11      RIGDEFNASYCPRR---------------GLLDNKSGRKQPPNGFCAPVT
A0A6I8NCK5_BCL2L11      RIGDEFNASYCPRR---------------GLLDNKSGRKQPPNGFCAPVT
A0A6I8NCK5_BCL2L11      RIGDEFNASYCPRR---------------EMLDVRPDLLGLGINSTLPGD
A0A6I8NCK5_BCL2L11      RIGDEFNASYCPRRTGMTGGLVFMGRLLSDMFAVRPE-VRRGLPSTPERT
                        **************                 :  ..              

A0A6I8NCK5_BCL2L11      EREKNFFGT-----------------------------------------
A0A6I8NCK5_BCL2L11      LHPPPRWRTAVTVSWRSEDPRVFTSSSAEQTRAVVASPIYNYAIDTVPHG
A0A6I8NCK5_BCL2L11      LHPPPRWRTAVTVSWRSEDPRVFTSSSAEQTRAVVASPIYNYAIDTVPHG
A0A6I8NCK5_BCL2L11      TLPHPGPDM-----------------------------------------
A0A6I8NCK5_BCL2L11      EREKNFFGT-----------------------------------------
                                                                          

© 1998-2021Legal notice