Dataset for protein Bim of organism Ornithorhynchus anatinus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A6I8NCK5_BCL2L11      MAKQPSDLNSECDSEGGRLEPAEGPAQPPQLRPGAPTSIRTQYQ------
A0A6I8NCK5_BCL2L11      MAKQPSDLNSECDSEGGRLEPAEGPAQPPQLRPGAPTSIRTQYQ------
A0A6I8NCK5_BCL2L11      MAKQPSDLNSECDSEGGRLEPAEGPAQPPQLRPGAPTSIRTQYQGNLSGG
A0A6I8NCK5_BCL2L11      MAKQPSDLNSECDSEGGRLEPAEGPAQPPQLRPGAPTSIRTQYQ------
A0A6I8NCK5_BCL2L11      MAKQPSDLNSECDSEGGRLEPAEGPAQPPQLRPGAPTSIRTQYQ------
                        ********************************************      

A0A6I8NCK5_BCL2L11      ----------------------------------------------DRSP
A0A6I8NCK5_BCL2L11      ----------------------------------------------DRSP
A0A6I8NCK5_BCL2L11      GESCSQGPFPPSSSPRPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSP
A0A6I8NCK5_BCL2L11      ----------------------------------------------DRSP
A0A6I8NCK5_BCL2L11      --------------------------------------------------
                                                                          

A0A6I8NCK5_BCL2L11      PPVSCDKSTQTPSPHCQAFNHYLSAMASIRQPQSVPEDMRPEIWIAQELR
A0A6I8NCK5_BCL2L11      PPVSCDKSTQTPSPHCQAFNHYLSAMASIRQPQSVPEDMRPEIWIAQELR
A0A6I8NCK5_BCL2L11      PPVSCDKSTQTPSPHCQAFNHYLSAMASIRQPQSVPEDMRPEIWIAQELR
A0A6I8NCK5_BCL2L11      PPVSCDKSTQTPSPHCQAFNHYLSAMASIRQPQSVPEDMRPEIWIAQELR
A0A6I8NCK5_BCL2L11      --------------------------ASIRQPQSVPEDMRPEIWIAQELR
                                                  ************************

A0A6I8NCK5_BCL2L11      RIGDEFNASYCPRRTGMTGGLVFMGRLLSDMFAVRPE-VRRGLPS-----
A0A6I8NCK5_BCL2L11      RIGDEFNASYCPRR---------------EMLDVRPDLLGLGINS-----
A0A6I8NCK5_BCL2L11      RIGDEFNASYCPRR-----------------FAVRPE-VRRGLPS-----
A0A6I8NCK5_BCL2L11      RIGDEFNASYCPRR-----------------GLLDNK-SGRKQPPNGFCA
A0A6I8NCK5_BCL2L11      RIGDEFNASYCPRR-----------------GLLDNK-SGRKQPPNGFCA
                        **************                   :  .       .     

A0A6I8NCK5_BCL2L11      --------------------------TPERTEREKNFFGT----------
A0A6I8NCK5_BCL2L11      --------------------------TLPGDTLPHPGPDM----------
A0A6I8NCK5_BCL2L11      --------------------------TPERTEREKNFFGT----------
A0A6I8NCK5_BCL2L11      PVTLHPPPRWRTAVTVSWRSEDPRVFTSSSAEQTRAVVASPIYNYAIDTV
A0A6I8NCK5_BCL2L11      PVTLHPPPRWRTAVTVSWRSEDPRVFTSSSAEQTRAVVASPIYNYAIDTV
                                                  *       .               

A0A6I8NCK5_BCL2L11      ---
A0A6I8NCK5_BCL2L11      ---
A0A6I8NCK5_BCL2L11      ---
A0A6I8NCK5_BCL2L11      PHG
A0A6I8NCK5_BCL2L11      PHG
                           

© 1998-2020Legal notice