Dataset for protein Noxa of organism Nomascus leucogenys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
. * **************                                               * :*:  *.* *  .
kl e              gtdplgtagtarnqagfgigmqlrftrgkkllssslsssplalprgh ee eca q r fgd

        90       100       110       120       130    
: ::                                  *..: :: ..*.*.  
klefpaetsesdiqtlllrnltasktcmrgllqksflr qkfhnfeek f ngt
© 1998-2023Legal notice