Dataset for protein Noxa of organism Nomascus leucogenys

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3HX97_PMAIP1-      KPGRARRNAQPSPAPAPA--------------------------------
A0A2I3HX97_PMAIP1-      SLGEARRNAQPSPAPAPAGTDPLGTAGTARNQAGFGIGMQLRFTRGKKLL
                        . * **************                                

A0A2I3HX97_PMAIP1-      ---------------ELEVECATQLRRFGDKLNF----------------
A0A2I3HX97_PMAIP1-      SSSLSSSPLALPRGHEEQVQVRTSLSRQKGQTELPAETSESDIQTLLLRN
                                       * :*:  *.* *  .: ::                

A0A2I3HX97_PMAIP1-      ------------------RQKLLNLISKLFCSGT
A0A2I3HX97_PMAIP1-      LTASKTCMRGLLQKSFLRRRTFHQFEERLHCN--
                                          *..: :: ..*.*.  

© 1998-2020Legal notice