Dataset for protein classical BH3-containing proteins of organism Nomascus leucogenys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------makqpsdv-----------ssec------------dregrqlqp----------aerppqlrpga----
mkfgmgsarac--qv-rpssvtwvpcqicavr--taaplgtrswavq-yspgprrmsdelvqstmeqglqrpkvagllsv
     slge rpcmev-a-hrgrsrsgppnp-pastprtpllqtpa-sthlvyaqlg  fhdr  wlpstarqsls g a
           rn-- c-l       a  g-ggtqgg plgggsgrrqregtwkn          trerattpr p    
            msc  qi          etedrh d   aael gnmpdfrrgm          qk f ssem l    
            ge    f           lcalg        g  llhaeliel          pi e lmak e    
             a    c           ga i            aka def a          ld a gg d d    
                  a                            g  aa             fa             
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------ptslqtepq-----------------------------------------------------
lrplrsrpscrpsrprpf---------gnpegnhggegdscphgspqgplapapgrrrshpggsgsprgggtvgpgdrgp
dlfaqalld plr lqlassthvss lrstrshedqvtvtlsrsrssqaprl                            
                  arc slr hlrltrqrrpgqqrtmpa qkpqvm                             
                   l  pcg gel dpm ekdppq al  dalgte                             
                      c d ead      fa lp  e                                     
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------drspapmscdkstqtpsppcqafnhy
aaadggrpqravraaetrgpaspgpfatrsplfifmrrssllsrsssgyfsfdt----rqvdvrrvggralfrprtlasw
                   acivtesdvslryqrlhqtpevtqhpqgprdiyqlnatt-at-rsdqwdq---aqdvwrlv
                    tgts mpqqtlvpshagl a amg l la ga qgecat--r---pm-kttl-vsrpewr
                     egp l legfal                     tlaiskyqtywmlr-srhqtppiqvl
                     aad e i                          l vegepps vlelpqnakrnl hqi
                                                      a d cdllq sfdeflf  emi  if
                                                             km g a c e  dkc  a 
                                                             el f     a   a     
                                                             c                  
                                                                                

       250       260       270       280       290       300       310 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
                                                                       
lsamcgm----------------------------------------------------------------
rnrlasrrqsvpadmrpeiwiaqelrrigdefnayyarrlfkwlasstedhprmvilrllryivrlvwrmh
geqn---lelevvqslwlmvpntldlpylsslsyqwpqfvhlnnyqas                       
y-levtwtvarrsmravflflllg ell hhhlvltn  neelfsk a                       
wkf-lvspsepgqil   ge f   daa  ggeqdle   a d                            
sd-iwrnipdaegh                                                         
iapfpnlgn   d                                                          
e   miie                                                               
    hcgd                                                               
    g f                                                                
      e                                                                
© 1998-2021Legal notice