Dataset for protein classical BH3-containing proteins of organism Nomascus leucogenys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mkfgmgsaracpcqvprassvtwvpcqicgprerhgprtpggqlpgarrgpgprrpaplparppgalgsvlrpmkfgmgs
                                                                         lslrpsr
                                                                          ra eac
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
makqPsdvssec------------dregrqlqpaerppqlrpga----------------------ptslqtepq-----
--aevcpaprgsptrplrttrthr--------------------llsadlfaqslldcplsrrrsh---------gnpeg
rrmc rql-eargld hgsagra rqgspvygsrsgqtavqvls                g lqlfsstsvssrglrtvs
ap-r grivapl            npadlpierqlsf ttkkcp                       lghscp lelltp
 nsk   fr na            lm  flfaqldee rpeaal                       g  g g eag r 
 mr    ch di                dg  mg a  nmc  g                          c d   d d 
 ge     a c                      e    gg                                        
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------gsp--p-a-pa--g-fa-----------s-----s---------drspapmscdks-----tqtpsppc
nhggegdscph---qg-l-p--sp-p--trsplfifmrr-sllsr-ssgyfsfdtrsaqlaaptrrydvrdsggrqrrrp
qedrvpvttspsvtwvavrlcegrtetdaqplalelpvqghegtpaltqgpqsrrqgltygtcapqvwewata---lqir
pgeqgtqrlmlarqsrqcqiactgsaspvplygrrgrql ehfvwrtmwrrrypsmqtrtsra--prvsvwq-tqsfnvl
m  kdqlqadg  dkqgtmgrlivrtw istt p  kam dveqq rglkglp pkpmgqnp-vmtgsrirlqplrvldk
h  fa aa  e   al pea  etpsq   rr a  g     amh  eiaail  andfdiktmlmerpdliplklthai
                       ld m         a      hd   f   a   a e  gqlel pmcgflefkeg g
                          e                               d  ede   f   deae aa f
                                                                   e   c  a     
                                                                                
                                                                                

       250       260       270       280       290       300       310       
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:..
                                                                             
qafnhylsamrsm----------------------------------------------------------------
dtwrsvynglavsleasptvmrpeiwiaqelrrigdefnayyarrvhknnyqaaedhprmvilrllryivrlvwrmh
relaq-nlrrvtlrqsvladslwfmllntsslsy lylsqdteqfnfldfs                          
ss w-rgefsgnkapqegvirwvllfpllp dlg hhhln     le                              
lp lvp-pwicr-illqvlhqa  ge fkg                                               
fn hrlqangmpwegepsg l   e                                                    
al  dke l lindfdmre                                                          
    af    igi  c  d                                                          
     e    hef                                                                
          dce                                                                
           aa                                                                
© 1998-2022Legal notice