Dataset for protein classical BH3-containing proteins of organism Nomascus leucogenys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------------makqPsdv-----------ssec------
mkfgmgsaracpcqvprassvtwvpcqicgprerhgprtpggqlpslrrgr---evcpihrgrsrsgppr----stsvlg
                                             gageaprpm- rql       a anvrpalggr r
                                                   gnsr gra          appglgadp  
                                                    mrk a f           ledi      
                                                    gec   c            ca       
                                                     a                 a        
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------dregrqlqp----------aerppqlrpga----------------------ptslqtepq-------------
trswaa--rparprrmsdelvqrtm-----r----gppsarlssqslprpppsrrrsh---------gnpegnhggegds
plrtrrqtystvaaqlgrcfplsphwlgra-tkvl-lll dgfa paldcalg lqlfsstsvssrglrtvsqedrvpvt
lags psqtnltysmaa   hd   rstlttsesas                       lghscp lelltppgeqgtqr
   a  nmgdflika          qrefrhrqrep                       g  g g eag r m  kdqlq
      llaadgfg           lpae gp k l                          c d   d d h  fa aa
      eg   e e           fk   em   c                                            
      ac                 ed    g                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------p-----------------------drspapmscdkstqtpsppcqafnhyls
cphgspqgplappaspgataappfatrs-lfifmrrssllsrsssgyfsfdt-----qvdvrrvggralfrprtlaswrn
tspsrqsravrlactvt     eldlelrvqshhgtpavtqgpqlprdgaqlnattrat-rsdqwdq---aqdvwrlvge
lmla dkqqtma eits      spvsglyrrleqqweremhalgramiy qglcat--r---pm-kttl-vsrpewry-
adg   algpe   grd      m qqtgapgeael   ai    l  ad  teaiskyqtywmlr-srhqtppiqvlwk
  e           eg       e i  f l                     a d gepps vlelpqnakrnl hqisd
                                                         dllq sfdeflf  emi  ifia
                                                           km g a c e  dkc  a e 
                                                           el f     a   a       
                                                           c                    
                                                                                

       250       260       270       280       290       300         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
                                                                     
amcgm----------------------------------------------------------------
rlasrrqsvpadmrpeiwiaqelrrigdefnayyarrlfkwlasstedhprmvilrllryivrlvwrmh
qn---lelevvqslwlmvpntldlpylsslsyqwpqfvhlnnyqas                       
levtwtvarrsmravflflllg ell hhhlvltn  neelfsk a                       
f-lvspsepgqil   ge f   daa  ggeqdle   a d                            
-iwrnipdaegh                                                         
pfpnlgn   d                                                          
  miie                                                               
  hcgd                                                               
  g f                                                                
    e                                                                
© 1998-2022Legal notice