Dataset for protein classical BH3-containing proteins of organism Nomascus leucogenys

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------mqpspvsrersreg---q----pptl-pg--tsl----q--------------------------------
mkpgrgsmakevcqlpsgce--vrql-paer--q-r--sv---qtep-gnpegnhggegdscphgspqgplappaspgpf
  f marrrac rdi-epsdvtwvpyeqllgg -vqapgprrpelrww                                
       ans    fvadl-mssllf iedee ntevlallgegeqss                                
        me    ch aillda  c  ca   gqc c agdad fld                                
        g     a   a d            ama         daa                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                            .                                                   
-----------------rcgprlrrmgdelspr-msrdkstqtssppc-a---yls------------------------
strsppfsrlqrsslaqe-aaq---fs-d-ndap-rcrrarslrava-q-lnh---wmvteaqvrvlyspmepkttvven
alpmellipmrlmpats-y--gyks--tkr---yl--plpsprphstttsfgvswpalqeaeptslfrafadgfsrfkad
  ldcd df  cfegsrltst- fptdq fvqvtkwlnqlekqlergspqqrtmsiygda disdae             
               lhcs se acla   mfsselkg ia kfcg ph mpqaf cdc   gra               
                dal r   ai    haqq fa  e       mg   l          q                
                  i                            a                                
                                                                                

       170       180       190       200        
....:....|....:....|....:....|....:....|....:...
                                                
--------a-wr------------------------------------
pplpaqpc-s--srnlgrrsswpsvlyvllvlllplprllsgplylpn
ii      vq wfpwpassvlrgrq ln img  l lpghragemel 
        sp pde   kgqeaeqp                       
        rn l      en    m                       
        ql d                                    
        fe                                      
         a                                      
© 1998-2020Legal notice