Dataset for protein classical BH3-containing proteins of organism Nomascus leucogenys

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3HX97_PMAIP1-      -KPGRARRNAQPSPAPAPAELEV---------------------------
A0A2I3HWI8_BBC3-03      MKFGMGSARACPCQVPRASSVTWVPCQICAGGPTQAAPGVRGEEEQWA--
G1S1X2_BIK-01           --------MSEVRPISRDILMESLLYEQLLEPPTMEVLGVTDPEEDLD--
A0A2I3HD83_BMF-01       ---------MEPSQCVEELEDDV--FQPEDGEPGTQPGSLLSADLFAQ--
A0A2I3GVB2_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ--
A0A2I3GVB2_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGN
A0A2I3H4B2_BAD-01       -------MGEEPSPF-RGRSRSA--------PPNL------------W--
G1QHD8_HRK-01           ---------MCPCPLHRGR---G--------PPAVCACSAGRLGLRSS--
                                                                          

A0A2I3HX97_PMAIP1-      -----------------------------------------------ECA
A0A2I3HWI8_BBC3-03      ----------------------------------------------REIG
G1S1X2_BIK-01           --------------------------------PMEDFDPLQCMEGSDALA
A0A2I3HD83_BMF-01       ------------------------------SLLDCPLSRLQLFPLTHCCG
A0A2I3GVB2_BCL2L11      --------------------------------------------------
A0A2I3GVB2_BCL2L11      PEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSS
A0A2I3H4B2_BAD-01       --------------------------------------------AAQRYG
G1QHD8_HRK-01           --------------------------------------------AAQLTA
                                                                          

A0A2I3HX97_PMAIP1-      TQLRRFGDKLNFRQKLLNLISKLFCSGT----------------------
A0A2I3HWI8_BBC3-03      AQLRRMADDLNAQYERRRQEEQQRHRP-----------------------
G1S1X2_BIK-01           PRLACIGDE-MDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSF
A0A2I3HD83_BMF-01       PGLRPTSQE--------DKATQTLSPASPSQGVMLPCGVTEEPQRLFYAP
A0A2I3GVB2_BCL2L11      --------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDEAAGSSLE---
A0A2I3GVB2_BCL2L11      SGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAM------------
A0A2I3H4B2_BAD-01       RELRRMSDEFVDS--FKGLPRPKSAGTATQMRQSSSW------TRVF---
G1QHD8_HRK-01           ARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAAL---
                                .                                         

A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A2I3HWI8_BBC3-03      ------------------SPWR------------VLYNLIMGLLPLPRGH
G1S1X2_BIK-01           MDGFTTFKENII------RLWRSPNPGSRVSREQMLLVLLVLLLLLLPLL
A0A2I3HD83_BMF-01       AEPKSRVVADPPLPAQPCFEWR-----REQEWGRP---------------
A0A2I3GVB2_BCL2L11      ------------------VQWPFEWLAKSS--------------------
A0A2I3GVB2_BCL2L11      ------------------ANWD----------------------------
A0A2I3H4B2_BAD-01       ------------------QSWWDRNLGRGSSAPSQ---------------
G1QHD8_HRK-01           ------------------AAWL---LGRRNL-------------------
                                                                          

A0A2I3HX97_PMAIP1-      --------
A0A2I3HWI8_BBC3-03      RAPEMEPN
G1S1X2_BIK-01           SGGLYLLN
A0A2I3HD83_BMF-01       --------
A0A2I3GVB2_BCL2L11      --------
A0A2I3GVB2_BCL2L11      --------
A0A2I3H4B2_BAD-01       --------
G1QHD8_HRK-01           --------
                                

© 1998-2020Legal notice