Dataset for protein classical BH3-containing proteins of organism Nomascus leucogenys

[Download (right click)] [Edit] [Sequences] [Repertoires]

17 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A2I3HWI8_BBC3-01      MKFGMGSARACPCQVPRASSVTWV--------------------------
A0A2I3HWI8_BBC3-03      MKFGMGSARACPCQVPRASSVTWV--------------------------
A0A2I3HWI8_BBC3-02      MKFGMGSARACPCQVPRASSVTWVPCQICGPRERHGPRTPGGQLPGARRG
G1S1X2_BIK-01           --------------------------------------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
A0A2I3HX97_PMAIP1-      ---------------------------------------------SLGEA
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
                                                                          

A0A2I3HX97_PMAIP1-      ----KPGRA----------------------------RRNAQPSP-----
A0A2I3HWI8_BBC3-01      -----PCQI--------------C------------ETRGATAAP-----
A0A2I3HWI8_BBC3-03      -----PCQI--------------C------------AGGPTQAAP-----
A0A2I3HWI8_BBC3-02      PGPRRPAPL--------PARPPGALGSVLRPLRARPSCRPRRPRPAARCL
G1S1X2_BIK-01           --MSEVRPI-----------SRDI------------LMESLLYEQ-----
A0A2I3H4B2_BAD-01       -MGEEPSPF-RGRSRSAPPNL------------WAAQRYGRELRRMSDEF
G1QHD8_HRK-01           ---MCPCPLHRGR---GPPAVCACSAGRLGLRSSAAQLTAARLKALGDEL
A0A2I3HD83_BMF-01       ---MEPSQC-----------VEEL--------------EDDVFQP-----
A0A2I3HX97_PMAIP1-      RRNAQPSPA-----------PAPAGTDPLGTAGTARNQAGFGIGM-----
A0A2I3GAA1_BCL2L11      -MAKQPSDV-----------SSEC------------DREGRQLQP-----
A0A2I3GAA1_BCL2L11      -MAKQPSDV-----------SSEC------------DREGRQLQP-----
A0A2I3GAA1_BCL2L11      -MAKQPSDV-----------SSEC------------DREGRQLQP-----
A0A2I3GAA1_BCL2L11      -MAKQPSDV-----------SSEC------------DREGRQLQP-----
A0A2I3GAA1_BCL2L11      -MAKQPSDV-----------SSEC------------DREGRQLQP-----
A0A2I3GAA1_BCL2L11      -MAKQPSDV-----------SSEC------------DREGRQLQP-----
A0A2I3GAA1_BCL2L11      -MAKQPSDV-----------SSEC------------DREGRQLQP-----
A0A2I3GAA1_BCL2L11      -MAKQPSDV-----------SSEC------------DREGRQLQP-----
                                                                          

A0A2I3HX97_PMAIP1-      -----APAPAELEVEC----------------------------------
A0A2I3HWI8_BBC3-01      --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2I3HWI8_BBC3-02      PLRPHRSTRRHRRPGGPPLARGSSQPAPRPAPGRRRSHPGGSGSPRGGGT
G1S1X2_BIK-01           -----LLEPPTMEVLG--------------------------VTDPEEDL
A0A2I3H4B2_BAD-01       VDS--FKGLPRPKSAG----------------------------------
G1QHD8_HRK-01           HQRTMWRRRARSRRAP----------------------------------
A0A2I3HD83_BMF-01       -----EDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRP
A0A2I3HX97_PMAIP1-      -----QLRFTRGKKLL----------------------SSSLSSSPLALP
A0A2I3GAA1_BCL2L11      -----AERPPQLRPGA----------------------PTSLQTEPQ---
A0A2I3GAA1_BCL2L11      -----AERPPQLRPGA----------------------PTSLQTEPQGNP
A0A2I3GAA1_BCL2L11      -----AERPPQLRPGA----------------------PTSLQTEPQGNP
A0A2I3GAA1_BCL2L11      -----AERPPQLRPGA----------------------PTSLQTEPQGNP
A0A2I3GAA1_BCL2L11      -----AERPPQLRPGA----------------------PTSLQTEPQGNP
A0A2I3GAA1_BCL2L11      -----AERPPQLRPGA----------------------PTSLQTEPQGNP
A0A2I3GAA1_BCL2L11      -----AERPPQLRPGA----------------------PTSLQTEPQ---
A0A2I3GAA1_BCL2L11      -----AERPPQLRPGA----------------------PTSLQTEPQ---
                                                                          

A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A2I3HWI8_BBC3-01      --------------------------------PLALEGPVQSHHGTPALT
A0A2I3HWI8_BBC3-03      --------------------------------------GVRGEEEQWARE
A0A2I3HWI8_BBC3-02      VGPGDRGPAAADGGRPQRAVRAAETRGATAAPPLALEGPVQSHHGTPALT
G1S1X2_BIK-01           DPMEDFDPLQCMEGSDALAPRLACIGD-----EMDVSLRAPRLAQLSEVA
A0A2I3H4B2_BAD-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
A0A2I3HD83_BMF-01       TSQEDKATQTLSPASPSQGVMLPCGVT-----EEPQRLFY----------
A0A2I3HX97_PMAIP1-      RGHEEQVQVRTSLSRQKGQTELPAETS-----ESDIQTLLLR--------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      EGNHGGEGDSCPHGSPQGPLAPPASPG-----PFATRSPLFIFMRRSSLL
A0A2I3GAA1_BCL2L11      EGNHGGEGDSCPHGSPQGPLAPPASPG-----PFATRSPLFIFMRRSSLL
A0A2I3GAA1_BCL2L11      EGNHGGEGDSCPHGSPQGPLAPPASPG-----PFATRSPLFIFMRRSSLL
A0A2I3GAA1_BCL2L11      EGNHGGEGDSCPHGSPQGPLAPPASPG-----PFATRSPLFIFMRRSSLL
A0A2I3GAA1_BCL2L11      EGNHGGEGDSCPHGSPQGPLAPPASPG-----PFATRSPLFIFMRRSSLL
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
                                                                          

A0A2I3HX97_PMAIP1-      -----------------ATQLRRFGDKLNFRQKLLNLISKLFCSGT----
A0A2I3HWI8_BBC3-01      QGPQSPRDGAQLGACTRPVDVRDSGGRPLPPPDTLASVGNFLCTM-----
A0A2I3HWI8_BBC3-03      IGAQLRRMADDLNA---QYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPR
A0A2I3HWI8_BBC3-02      QGPQSPRDGAQLGACTRPVDVRDSGGRPLPPPDTLASVGNFLCTM-----
G1S1X2_BIK-01           MHSLGLAFIYDQTEDIRDVLRSFMDGFTTFKENIIRLWRSPNPGSRVSRE
A0A2I3H4B2_BAD-01       --------------TATQMRQSSSW------TRVFQSWWDRNLGRGSSAP
G1QHD8_HRK-01           --------------APGALPTYWPWLCAAAQVAALAAWL---LGRRNL--
A0A2I3HD83_BMF-01       --------------APAEPKSRVVADPPLPAQPCFEWRREQEWGRP----
A0A2I3HX97_PMAIP1-      ------------NLTASKTCMRGLLQKSFLRRRTFHQFEERLHCN-----
A0A2I3GAA1_BCL2L11      ------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDVG
A0A2I3GAA1_BCL2L11      SRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEP
A0A2I3GAA1_BCL2L11      SRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEP
A0A2I3GAA1_BCL2L11      SRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVV
A0A2I3GAA1_BCL2L11      SRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE----
A0A2I3GAA1_BCL2L11      SRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD----
A0A2I3GAA1_BCL2L11      ------------A----------SMRQAEPADMRPEIWIAQE--------
A0A2I3GAA1_BCL2L11      ------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM--------
                                                                          

A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A2I3HWI8_BBC3-01      --------------------------------------------------
A0A2I3HWI8_BBC3-03      GHRAPEMEPN----------------------------------------
A0A2I3HWI8_BBC3-02      --------------------------------------------------
G1S1X2_BIK-01           QMLLVLLVLLLLLLPLLSGGLYLLN-------------------------
A0A2I3H4B2_BAD-01       SQ------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A2I3GAA1_BCL2L11      DISLWFGFIFTGLDLYGHHHSQDTEQFNHKDFS-----------------
A0A2I3GAA1_BCL2L11      ADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRY
A0A2I3GAA1_BCL2L11      ADMRPEIWIAQELRRIGDEFNAYYARRLEK--------------------
A0A2I3GAA1_BCL2L11      V-------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      ------------LRRIGDEFNAYYARRLAKLLASST--------------
A0A2I3GAA1_BCL2L11      ------------DEAAGSSLEVQWP---FEWLAKSS--------------
                                                                          

A0A2I3HX97_PMAIP1-      ---------
A0A2I3HWI8_BBC3-01      ---------
A0A2I3HWI8_BBC3-03      ---------
A0A2I3HWI8_BBC3-02      ---------
G1S1X2_BIK-01           ---------
A0A2I3H4B2_BAD-01       ---------
G1QHD8_HRK-01           ---------
A0A2I3HD83_BMF-01       ---------
A0A2I3HX97_PMAIP1-      ---------
A0A2I3GAA1_BCL2L11      ---------
A0A2I3GAA1_BCL2L11      IVRLVWRMH
A0A2I3GAA1_BCL2L11      ---------
A0A2I3GAA1_BCL2L11      ---------
A0A2I3GAA1_BCL2L11      ---------
A0A2I3GAA1_BCL2L11      ---------
A0A2I3GAA1_BCL2L11      ---------
A0A2I3GAA1_BCL2L11      ---------
                                 

© 1998-2022Legal notice