Dataset for protein classical BH3-containing proteins of organism Nomascus leucogenys

[Download (right click)] [Edit] [Sequences] [Repertoires]

17 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3HX97_PMAIP1-      -----------------------------------------------KPG
A0A2I3HWI8_BBC3-01      MKFGMGSARACPCQVPRASSVTWVPCQICETRGATAAPPLALEGPVQSHH
A0A2I3HWI8_BBC3-03      MKFGMGSARACPCQVPRASSVTWVPCQICAGGPTQAAP------GVRGEE
A0A2I3HWI8_BBC3-02      MKFGMGSARACPCQVPRASSVTWVPCQICGPRERHGPRTPGGQLPGARRG
G1S1X2_BIK-01           ------------MSEVRPI-----------SRDI------------LMES
A0A2I3H4B2_BAD-01       -----------MGEEPSPF-RGRSRSAPPNL------------WAAQRYG
G1QHD8_HRK-01           -------------MCPCPLHRGR---GPPAVCACSAGRLGLRSSAAQLTA
A0A2I3HD83_BMF-01       -------------MEPSQC-----------VEEL--------------ED
A0A2I3HX97_PMAIP1-      -----SLGEARRNAQPSPA-----------PAPAGTDPLGTAGTARNQAG
A0A2I3GAA1_BCL2L11      -----------MAKQPSDV-----------SSEC------------DREG
A0A2I3GAA1_BCL2L11      -----------MAKQPSDV-----------SSEC------------DREG
A0A2I3GAA1_BCL2L11      -----------MAKQPSDV-----------SSEC------------DREG
A0A2I3GAA1_BCL2L11      -----------MAKQPSDV-----------SSEC------------DREG
A0A2I3GAA1_BCL2L11      -----------MAKQPSDV-----------SSEC------------DREG
A0A2I3GAA1_BCL2L11      -----------MAKQPSDV-----------SSEC------------DREG
A0A2I3GAA1_BCL2L11      -----------MAKQPSDV-----------SSEC------------DREG
A0A2I3GAA1_BCL2L11      -----------MAKQPSDV-----------SSEC------------DREG
                                                                          

A0A2I3HX97_PMAIP1-      RARRN----------AQPSPAPAPAE------------------------
A0A2I3HWI8_BBC3-01      GTPAL----------TQGPQSPRDGA------------------------
A0A2I3HWI8_BBC3-03      EQWAR----------EIGAQLRRMAD------------------------
A0A2I3HWI8_BBC3-02      PGPRR----------PAPLPARPPGALGSVLRPLRARPSCRPRRPRPAAR
G1S1X2_BIK-01           LLYEQ----------LLEPPTMEVLG------------------------
A0A2I3H4B2_BAD-01       RELRRMSDEFVDS--FKGLPRPKSAG------------------------
G1QHD8_HRK-01           ARLKALGDELHQRTMWRRRARSRRAP------------------------
A0A2I3HD83_BMF-01       DVFQP----------EDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPL
A0A2I3HX97_PMAIP1-      FGIGM----------QLRFTRGKKLL----------------------SS
A0A2I3GAA1_BCL2L11      RQLQP----------AERPPQLRPGA----------------------PT
A0A2I3GAA1_BCL2L11      RQLQP----------AERPPQLRPGA----------------------PT
A0A2I3GAA1_BCL2L11      RQLQP----------AERPPQLRPGA----------------------PT
A0A2I3GAA1_BCL2L11      RQLQP----------AERPPQLRPGA----------------------PT
A0A2I3GAA1_BCL2L11      RQLQP----------AERPPQLRPGA----------------------PT
A0A2I3GAA1_BCL2L11      RQLQP----------AERPPQLRPGA----------------------PT
A0A2I3GAA1_BCL2L11      RQLQP----------AERPPQLRPGA----------------------PT
A0A2I3GAA1_BCL2L11      RQLQP----------AERPPQLRPGA----------------------PT
                                                                          

A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A2I3HWI8_BBC3-01      --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2I3HWI8_BBC3-02      CLPLRPHRSTRRHRRPGGPPLARGSSQPAPRPAPGRRRSHPGGSGSPRGG
G1S1X2_BIK-01           --VTDPEEDLDPMEDFDPLQCMEGSDALAPRL------------------
A0A2I3H4B2_BAD-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
A0A2I3HD83_BMF-01       THCCGPGLRPTSQEDKATQTLSPASPSQGVML------------------
A0A2I3HX97_PMAIP1-      SLSSSPLALPRGHEEQVQVRTSLSRQKGQTEL------------------
A0A2I3GAA1_BCL2L11      SLQTEPQ-------------------------------------------
A0A2I3GAA1_BCL2L11      SLQTEPQ-------------------------------------------
A0A2I3GAA1_BCL2L11      SLQTEPQ-------------------------------------------
A0A2I3GAA1_BCL2L11      SLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAP------------------
A0A2I3GAA1_BCL2L11      SLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAP------------------
A0A2I3GAA1_BCL2L11      SLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAP------------------
A0A2I3GAA1_BCL2L11      SLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAP------------------
A0A2I3GAA1_BCL2L11      SLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAP------------------
                                                                          

A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A2I3HWI8_BBC3-01      --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2I3HWI8_BBC3-02      GTVGPGDRGPAAADGGRPQRAVRAAETRGATAAPPLALEGPVQSHHGTPA
G1S1X2_BIK-01           -----------------------------ACIGDEMDVSLRAPRLAQLSE
A0A2I3H4B2_BAD-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
A0A2I3HD83_BMF-01       -----------------------------PCGVTEEPQRLFY--------
A0A2I3HX97_PMAIP1-      -----------------------------PAETSESDIQTLLLR------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      -----------------------------PASPGPFATRSPLFIFMRRSS
A0A2I3GAA1_BCL2L11      -----------------------------PASPGPFATRSPLFIFMRRSS
A0A2I3GAA1_BCL2L11      -----------------------------PASPGPFATRSPLFIFMRRSS
A0A2I3GAA1_BCL2L11      -----------------------------PASPGPFATRSPLFIFMRRSS
A0A2I3GAA1_BCL2L11      -----------------------------PASPGPFATRSPLFIFMRRSS
                                                                          

A0A2I3HX97_PMAIP1-      --------------LEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT--
A0A2I3HWI8_BBC3-01      ------------QLGACTRPVDVRDSGGRPLPPPDTLASVGNFLCTM---
A0A2I3HWI8_BBC3-03      ------------DLNA---QYERRRQEEQQRHRPSPWRVLYNLIMGLLPL
A0A2I3HWI8_BBC3-02      LTQGPQSPRDGAQLGACTRPVDVRDSGGRPLPPPDTLASVGNFLCTM---
G1S1X2_BIK-01           VAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTFKENIIRLWRSPNPGSRVS
A0A2I3H4B2_BAD-01       ----------------TATQMRQSSSW------TRVFQSWWDRNLGRGSS
G1QHD8_HRK-01           ----------------APGALPTYWPWLCAAAQVAALAAWL---LGRRNL
A0A2I3HD83_BMF-01       ----------------APAEPKSRVVADPPLPAQPCFEWRREQEWGRP--
A0A2I3HX97_PMAIP1-      --------------NLTASKTCMRGLLQKSFLRRRTFHQFEERLHCN---
A0A2I3GAA1_BCL2L11      --------------A----------SMRQAEPADMRPEIWIAQE------
A0A2I3GAA1_BCL2L11      --------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAM------
A0A2I3GAA1_BCL2L11      --------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILED
A0A2I3GAA1_BCL2L11      LLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQA
A0A2I3GAA1_BCL2L11      LLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQA
A0A2I3GAA1_BCL2L11      LLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE--
A0A2I3GAA1_BCL2L11      LLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD--
A0A2I3GAA1_BCL2L11      LLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEE
                                                                          

A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A2I3HWI8_BBC3-01      --------------------------------------------------
A0A2I3HWI8_BBC3-03      PRGHRAPEMEPN--------------------------------------
A0A2I3HWI8_BBC3-02      --------------------------------------------------
G1S1X2_BIK-01           REQMLLVLLVLLLLLLPLLSGGLYLLN-----------------------
A0A2I3H4B2_BAD-01       APSQ----------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------LRRIGDEFNAYYARRLAKLLASST------------
A0A2I3GAA1_BCL2L11      --------------DEAAGSSLEVQWP---FEWLAKSS------------
A0A2I3GAA1_BCL2L11      VGDISLWFGFIFTGLDLYGHHHSQDTEQFNHKDFS---------------
A0A2I3GAA1_BCL2L11      EPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLL
A0A2I3GAA1_BCL2L11      EPADMRPEIWIAQELRRIGDEFNAYYARRLEK------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      VVV-----------------------------------------------
                                                                          

A0A2I3HX97_PMAIP1-      -----------
A0A2I3HWI8_BBC3-01      -----------
A0A2I3HWI8_BBC3-03      -----------
A0A2I3HWI8_BBC3-02      -----------
G1S1X2_BIK-01           -----------
A0A2I3H4B2_BAD-01       -----------
G1QHD8_HRK-01           -----------
A0A2I3HD83_BMF-01       -----------
A0A2I3HX97_PMAIP1-      -----------
A0A2I3GAA1_BCL2L11      -----------
A0A2I3GAA1_BCL2L11      -----------
A0A2I3GAA1_BCL2L11      -----------
A0A2I3GAA1_BCL2L11      RYIVRLVWRMH
A0A2I3GAA1_BCL2L11      -----------
A0A2I3GAA1_BCL2L11      -----------
A0A2I3GAA1_BCL2L11      -----------
A0A2I3GAA1_BCL2L11      -----------
                                   

© 1998-2022Legal notice