Dataset for protein classical BH3-containing proteins of organism Nomascus leucogenys

[Download (right click)] [Edit] [Sequences] [Repertoires]

17 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2I3HWI8_BBC3-01      --------------------------------------------------
A0A2I3HWI8_BBC3-02      MKFGMGSARACPCQVPRASSVTWVPCQICGPRERHGPRTPGGQLPGARRG
A0A2I3H4B2_BAD-01       --------------------------------------------------
G1QHD8_HRK-01           --------------------------------------------------
G1S1X2_BIK-01           --------------------------------------------------
A0A2I3HD83_BMF-01       --------------------------------------------------
A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
A0A2I3GAA1_BCL2L11      --------------------------------------------------
                                                                          

A0A2I3HX97_PMAIP1-      ---------------------------------KPGRARRNA--------
A0A2I3HWI8_BBC3-03      -----------------------MKFGMGSARACPCQVPRAS--------
A0A2I3HWI8_BBC3-01      -----------------------MKFGMGSARACPCQVPRAS--------
A0A2I3HWI8_BBC3-02      PGPRRPAPLPARPPGALGSVLRPLRARPSCRPRRPRPAARCLPLRPHRST
A0A2I3H4B2_BAD-01       ------------------------------MGEEPSPF-RGR--------
G1QHD8_HRK-01           --------------------------------MCPCPLHRGR--------
G1S1X2_BIK-01           -------------------------------MSEVRPISRDI--------
A0A2I3HD83_BMF-01       --------------------------------MEPSQCVEEL--------
A0A2I3HX97_PMAIP1-      ------------------------SLGEARRNAQPSPAPAPAGTDPLGTA
A0A2I3GAA1_BCL2L11      ------------------------------MAKQPSDVSSEC--------
A0A2I3GAA1_BCL2L11      ------------------------------MAKQPSDVSSEC--------
A0A2I3GAA1_BCL2L11      ------------------------------MAKQPSDVSSEC--------
A0A2I3GAA1_BCL2L11      ------------------------------MAKQPSDVSSEC--------
A0A2I3GAA1_BCL2L11      ------------------------------MAKQPSDVSSEC--------
A0A2I3GAA1_BCL2L11      ------------------------------MAKQPSDVSSEC--------
A0A2I3GAA1_BCL2L11      ------------------------------MAKQPSDVSSEC--------
A0A2I3GAA1_BCL2L11      ------------------------------MAKQPSDVSSEC--------
                                                                          

A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A2I3HWI8_BBC3-03      --------------------------------------------------
A0A2I3HWI8_BBC3-01      --------------------------------------------------
A0A2I3HWI8_BBC3-02      RRHRRPGGPPLARGSSQPAPRPAP----------------GRRRSHPGGS
A0A2I3H4B2_BAD-01       ------------SRSAPPNL------------------------------
G1QHD8_HRK-01           ---------------GPPAVCACS--------------------------
G1S1X2_BIK-01           ----LMESLLYEQLLEPPTMEVLG--------------------------
A0A2I3HD83_BMF-01       ------EDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTH
A0A2I3HX97_PMAIP1-      GTARNQAGFGIGMQLRFTRGKKLL----------------------SSSL
A0A2I3GAA1_BCL2L11      ----DREGRQLQPAERPPQLRPGA----------------------PTSL
A0A2I3GAA1_BCL2L11      ----DREGRQLQPAERPPQLRPGA----------------------PTSL
A0A2I3GAA1_BCL2L11      ----DREGRQLQPAERPPQLRPGA----------------------PTSL
A0A2I3GAA1_BCL2L11      ----DREGRQLQPAERPPQLRPGA----------------------PTSL
A0A2I3GAA1_BCL2L11      ----DREGRQLQPAERPPQLRPGA----------------------PTSL
A0A2I3GAA1_BCL2L11      ----DREGRQLQPAERPPQLRPGA----------------------PTSL
A0A2I3GAA1_BCL2L11      ----DREGRQLQPAERPPQLRPGA----------------------PTSL
A0A2I3GAA1_BCL2L11      ----DREGRQLQPAERPPQLRPGA----------------------PTSL
                                                                          

A0A2I3HX97_PMAIP1-      --------------------------------------------------
A0A2I3HWI8_BBC3-03      ---------------------SVTWVPCQICAGGPTQAAP------GVRG
A0A2I3HWI8_BBC3-01      ---------------------SVTWVPCQICETRGATAAPPLALEGPVQS
A0A2I3HWI8_BBC3-02      GSPRGGGTVGPGDRGPAAADGGRPQRAVRAAETRGATAAPPLALEGPVQS
A0A2I3H4B2_BAD-01       ------------------------------------WAAQRYGRELRRMS
G1QHD8_HRK-01           ----------------------------AGRLGLRSSAAQLTAARLKALG
G1S1X2_BIK-01           VTDPEEDLDPMEDFDPLQCMEGSDALAPRLACIGDEMDVSLRAPRLAQLS
A0A2I3HD83_BMF-01       CCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEP------------
A0A2I3HX97_PMAIP1-      SSSPLALPRGHEEQVQVRTSLSRQKGQTELPAETSESDIQTLLL------
A0A2I3GAA1_BCL2L11      QTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS
A0A2I3GAA1_BCL2L11      QTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS
A0A2I3GAA1_BCL2L11      QTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS
A0A2I3GAA1_BCL2L11      QTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS
A0A2I3GAA1_BCL2L11      QTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRS
A0A2I3GAA1_BCL2L11      QTEPQ---------------------------------------------
A0A2I3GAA1_BCL2L11      QTEPQ---------------------------------------------
A0A2I3GAA1_BCL2L11      QTEPQ---------------------------------------------
                                                                          

A0A2I3HX97_PMAIP1-      ---------------QPSPAPAPAELEVECATQLRRFGDKLNFRQKLLNL
A0A2I3HWI8_BBC3-03      EEEQWAREIGAQLRRMADDLNA---QYERRRQEEQQRHRPSPWRVLYNLI
A0A2I3HWI8_BBC3-01      HHGTPALTQGPQSPRDGAQLGACTRPVDVRDSGGRPLPPPDTLASVGNFL
A0A2I3HWI8_BBC3-02      HHGTPALTQGPQSPRDGAQLGACTRPVDVRDSGGRPLPPPDTLASVGNFL
A0A2I3H4B2_BAD-01       DEFVDS--FKGLPRPKSAGTATQMRQSSSW------TRVFQSWWDRNLGR
G1QHD8_HRK-01           DELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWL---LGR
G1S1X2_BIK-01           EVAMHSLGLAFIY--DQTEDIRDVLRSFMDGFTTFKENIIRLWRSPNPGS
A0A2I3HD83_BMF-01       ---------------QRLFYAPAEPKSRVVADPPLPAQPCFEWRREQEWG
A0A2I3HX97_PMAIP1-      ---------------RNLTASKTCMRG----LLQKSFLRRRTFHQFEERL
A0A2I3GAA1_BCL2L11      SLLSRSSSGYFSFDTDRSPAPMSCDKS-----TQTPSPPCQAFNHYLSAM
A0A2I3GAA1_BCL2L11      SLLSRSSSGYFSFDTDRSPAPMSCDKS-----TQTPSPPCQAFNHYLSAM
A0A2I3GAA1_BCL2L11      SLLSRSSSGYFSFDTDRSPAPMSCDKS-----TQTPSPPCQAFNHYLSAM
A0A2I3GAA1_BCL2L11      SLLSRSSSGYFSFDTDRSPAPMSCDKS-----TQTPSPPCQAFNHYLSAM
A0A2I3GAA1_BCL2L11      SLLSRSSSGYFSFDTDRSPAPMSCDKS-----TQTPSPPCQAFNHYLSAM
A0A2I3GAA1_BCL2L11      ---------------ASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARR
A0A2I3GAA1_BCL2L11      ---------------DRSPAPMSCDKS-----TQTPSPPCQAFNHYLSAM
A0A2I3GAA1_BCL2L11      ---------------DRSPAPMSCDKS-----TQTPSPPCQAFNHYLSAM
                                                                          

A0A2I3HX97_PMAIP1-      ISKLFCSGT-----------------------------------------
A0A2I3HWI8_BBC3-03      MGLLPLPRGHRAPEMEPN--------------------------------
A0A2I3HWI8_BBC3-01      CTM-----------------------------------------------
A0A2I3HWI8_BBC3-02      CTM-----------------------------------------------
A0A2I3H4B2_BAD-01       GSSAPSQ-------------------------------------------
G1QHD8_HRK-01           RNL-----------------------------------------------
G1S1X2_BIK-01           RVSREQMLLVLLVLLLLLLPLLSGGLYLLN--------------------
A0A2I3HD83_BMF-01       RP------------------------------------------------
A0A2I3HX97_PMAIP1-      HCN-----------------------------------------------
A0A2I3GAA1_BCL2L11      ASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRM
A0A2I3GAA1_BCL2L11      ASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLEK------------
A0A2I3GAA1_BCL2L11      VREIEEVVV-----------------------------------------
A0A2I3GAA1_BCL2L11      ANWD----------------------------------------------
A0A2I3GAA1_BCL2L11      GIFE----------------------------------------------
A0A2I3GAA1_BCL2L11      LAKLLASST-----------------------------------------
A0A2I3GAA1_BCL2L11      DEAAGSSLEVQWPFEWLAKSS-----------------------------
A0A2I3GAA1_BCL2L11      VVILEDVGDISLWFGFIFTGLDLYGHHHSQDTEQFNHKDFS---------
                                                                          

A0A2I3HX97_PMAIP1-      -----------------
A0A2I3HWI8_BBC3-03      -----------------
A0A2I3HWI8_BBC3-01      -----------------
A0A2I3HWI8_BBC3-02      -----------------
A0A2I3H4B2_BAD-01       -----------------
G1QHD8_HRK-01           -----------------
G1S1X2_BIK-01           -----------------
A0A2I3HD83_BMF-01       -----------------
A0A2I3HX97_PMAIP1-      -----------------
A0A2I3GAA1_BCL2L11      VILRLLRYIVRLVWRMH
A0A2I3GAA1_BCL2L11      -----------------
A0A2I3GAA1_BCL2L11      -----------------
A0A2I3GAA1_BCL2L11      -----------------
A0A2I3GAA1_BCL2L11      -----------------
A0A2I3GAA1_BCL2L11      -----------------
A0A2I3GAA1_BCL2L11      -----------------
A0A2I3GAA1_BCL2L11      -----------------
                                         

© 1998-2022Legal notice