Dataset for protein Bim of organism Neovison vison

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************************************                                       
MAKQPSDVSSECDREGGQLQPVERPPQLRPGAPTSLQTEQQ---------------------------------------
                                         gnpegegdrcpqgspqgplappaspgpfatrsplfifvr
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                               *********************************
-----------------drspapmscdkstqtpsppcqafnhylsamASRRQSQAVPADMRPEMWIAQELRRIGDEFNAY
rssllsrsssgyfsfdt------------------------------                                 
                                                                                

       170       180       190      
....:....|....:....|....:....|....:.
****:                               
YPRRleq-----------------------------
    vfrnpyscleahpqmiilrllryiirlvwrlq
     alinapaac                      
© 1998-2020Legal notice