Dataset for protein Bim of organism Neovison vison

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


U6CTE3_BCL2L11-04      MAKQPSDVSSECDREGGQLQPVERPPQLRPGAPTSLQTEQQ---------
U6CTE3_BCL2L11-03      MAKQPSDVSSECDREGGQLQPVERPPQLRPGAPTSLQTEQQ---------
U6CTE3_BCL2L11-02      MAKQPSDVSSECDREGGQLQPVERPPQLRPGAPTSLQTEQQGNPEGEGDR
U6CTE3_BCL2L11-01      MAKQPSDVSSECDREGGQLQPVERPPQLRPGAPTSLQTEQQGNPEGEGDR
                       *****************************************         

U6CTE3_BCL2L11-04      --------------------------------------------------
U6CTE3_BCL2L11-03      -----------------------------------------------DRS
U6CTE3_BCL2L11-02      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
U6CTE3_BCL2L11-01      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
                                                                         

U6CTE3_BCL2L11-04      ---------------------------ASRRQSQAVPADMRPEMWIAQEL
U6CTE3_BCL2L11-03      PAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQSQAVPADMRPEMWIAQEL
U6CTE3_BCL2L11-02      PAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQSQAVPADMRPEMWIAQEL
U6CTE3_BCL2L11-01      PAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQSQAVPADMRPEMWIAQEL
                                                  ***********************

U6CTE3_BCL2L11-04      RRIGDEFNAYYPRRLARIPASCLC----------------------
U6CTE3_BCL2L11-03      RRIGDEFNAYYPRRLEQ-----------------------------
U6CTE3_BCL2L11-02      RRIGDEFNAYYPRRLEQ-----------------------------
U6CTE3_BCL2L11-01      RRIGDEFNAYYPRRVFLNNYPAAEAHPQMIILRLLRYIIRLVWRLQ
                       **************:                               

© 1998-2020Legal notice