Dataset for protein classical BH3-containing proteins of organism Neogobius melanostomus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                             ..*             . :
---------------------------------------------------p-p-lygigrirLss-----------esq
medeeddvfepelqcwhstftqsksesrptqtpgpeqgpskkmqrklvmpl-r-rgpyshnvk htpvqyepvesdnktn
               maas riidc ddasedldealanragalpfgqlkevqlpfnsnag  fcahfdlsd   dqe
                                                aea e l a                       

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
...   :.  :: :. *         ... *.*  .    *.:*. :.*:*     .       *. *:     **    
vcg---earaeeelgtPtdgfpfrgrsksaPpAlwaakkyGrqLrrmsDeFdsmldkg------NsrPiqhsktWW----
tssplqqgemqngvdq ---------prql a hsveaci qk qlig q hrdhlrlyqrkqr qg v-----  rlaa
   lgld                                                   emkhmk                
                                                                                

       170       180    
....:....|....:....|....
   * *:..    . . ..:    
---SyLfshqetegenhhdsqrte
all l ldrggfmagggrgaagqr
                        
                        
© 1998-2022Legal notice