Dataset for protein classical BH3-containing proteins of organism Neogobius melanostomus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                                             ..*             . :
medeeddvfepelqcwhstftqsksesrptqtpgpeqgpskkmqrklvmpl-r-rgpyshnvk htpvqyepvesdnktn
               maas riidc ddasedldealanragalpfgqlkevqlpfnsnag  fcahfdlsd   dqe
                                                aea e l a                       

        90       100       110       120       130       140       150       160
...   :.  :: :. *         ... *.*  .    *.:*. :.*:*     .       *. *:     **    
tssplqqgemqngvdq ---------prql a hsveaci qk qlig q hrdhlrlyqrkqr qg v-----  rlaa
   lgld                                                   emkhmk                

       170       180    
   * *:..    . . ..:    
all l ldrggfmagggrgaagqr
© 1998-2023Legal notice