Dataset for protein classical BH3-containing proteins of organism Neogobius melanostomus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6U3U8_BMF-01      MEDEEDDVFEPELQCWHSTFRQIKCEDRATQTPGPALAPSKGMLPFGVAE
A0A8C6U7V6_BAD-03      ------------------------------------------------MP
A0A8C6U7V6_BAD-01      ---------------MAASFTISDSESDPSEDLDEEQGNRAKAQRKLQLK
A0A8C6U7V6_BAD-02      --------------------------------------------------
                                                                         

A0A8C6U3U8_BMF-01      EPRPLFYGNAGFRLHFPAHFELVE---DQETSGPLQDGEMQNGVDQP---
A0A8C6U7V6_BAD-03      AVQPPLPYSHNVKLSTCVQYDPSDSDNKTNTCSLGLQARAEEELGTPTDG
A0A8C6U7V6_BAD-01      LPELRGAGIGRIRLSS-----------ESQVCG---EARAEEELGTPTDG
A0A8C6U7V6_BAD-02      -----LNSIGRIRLSS-----------ESQVCG---EARAEEELGTPTDG
                                  ..*             . :...   :.  :: :. *   

A0A8C6U3U8_BMF-01      ------PRQLPAAHSVEACIGQKLQLIGDQFHRDHLRLYQRHQRNQGPV-
A0A8C6U7V6_BAD-03      FPFRGRSKSAPPALWAAKKYGRQLRRMSDEFDSMLDKG------NSRPIQ
A0A8C6U7V6_BAD-01      FPFRGRSKSAPPALWAAKKYGRQLRRMSDEFDSMLDKGEMKKMKNSRPIQ
A0A8C6U7V6_BAD-02      FPFRGRSKSAPPALWAAKKYGRQLRRMSDEFDSMLDKG------NSRPIQ
                             ... *.*  .    *.:*. :.*:*     .       *. *: 

A0A8C6U3U8_BMF-01      ----WWRLAAALLSLLLDRGGFMAGGGRGAAGQR
A0A8C6U7V6_BAD-03      HSKTWW-------SYLFSHQETEGENHHDSQRTE
A0A8C6U7V6_BAD-01      HSKTWW-------SYLFSHQETEGENHHDSQRTE
A0A8C6U7V6_BAD-02      HSKTWW-------SYLFSHQETEGENHHDSQRTE
                           **       * *:..    . . ..:    

© 1998-2022Legal notice