Dataset for protein classical BH3-containing proteins of organism Mus musculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mpgagvfwkqyravcrgllprqlapaavaaaaratashrsplefapffpiecghqaprvfftldpgaepwhhnseaetlm
                                                                               s
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------p--qlpcpptrsqlpp------pg------
wmapqeseppqcvegledsdrgidvlqsedgeprtrpgarlmaqlvpktv-ss--da---a-e-g-lttpcg--pymlrv
gtskgpmsvsspale rrc pegrsfgpdersrgwqsegltsfrimieffaqesv--srv-r-t-salhevrdvdplepg
aspr  gls eh    ak     gq   aa p qpm l qs pddesqseshdneeqnlsglgqf skecdqetrlqacw
 rh    da a      e             g  lf a p  lst agrpcdvms vdahdgrgq maylas r fgt s
                                            a  cqn rrgg rc e pp l  vpg a a  a  p
                                                gl epec  a a aa     c          m
                                                 k  g a                         
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------rlraigde----lrspr----lvqlpggaies----------------------r-rsyprtlvpg------
llrnqvalq-pcst-smhlcalametpsr------i--krpqrpsygnagyrlelsasrppr-svtpspngwravrvegq
eggsnihq-ra---n-ldtq-g--asrvqhssy c-vthdtptlfpspeqmeepsppffgigla-geqtdraa-    ee
paptvtrrlg-iaqedkaggt-yt-wttvgrmm aktq--g q  lpcqaqnhy  vpssaesmapadlsprqp      
gtfqff assqlvrskhyrtssrrsidggrapr rssepe          fh     maa  qpqes eqeq m      
f aie   aplkl aavgcrwmqfdf  d   a m pr                        allar  pal f      
a                     g             cd                            q  g g e      
                                                                  g             
                                                                                

       250       260       270       280       290       300      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
                                                                  
---rrlirqlrrmrdniwswf-----------qdpgqlfplvql-ffllg-awyrq----------
fifqsygasitnllqefn-qrvrtpgawvspdnqtrpqmnmil-vlni--l---l-lqregvgpwq
elqkdievepapigekv-g--kllhtvndyrqhlrqk-lww--vl-l-vtgwln-nenspest s 
 dlh-ecqt s ksrcredsyhvrvsq   qsagqa-vaa-wskwt-mqnsv rnhrgkg me n 
 wc-ka--a l pc alapyltgsrrp   khsan-ts--rsvynrr irdp p gpraa      
 saie-t     aa d  ht e  aqe   eedrmnrrrvqqmgfq  hq   l d          
   d sa           e      f     ccehhddprinafa   gl   d            
                  a               dd  e  l      f                 
                                  a      a                        
© 1998-2020Legal notice