Dataset for protein classical BH3-containing proteins of organism Mus musculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mpgagvfwkqyravcrgllprqlapaavaaaaratashrsplemgtpkqpslapahalglrksdpgirslgsdaggrrwr
                                           fapffpiecghqaprvfftl   aepwhhnseaetls
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------ps---dasarerg--p----sltpdqpgp-----lmpgllgsnqheqg-------------------
paaqsmfqipafe--eqe----tdd-lp-epve---------yplgr-a--apsclltapqgnpdgegdrcphgspqgpl
wsspgemmsmekqmedvsserd---qsgqp taqeqeaerp qrdvdq-es--t--ivqlr                   
 mh   xepeqrvearevmvcvsqgnvsgt  rg arsskr fhr  grgcvv-rs-f---                   
           cl  lddiktqphe e vn   a l tm e v     p ame adecras                   
                 mpgfkar  a          pc c r         f  gd-                      
                                     m              c    a                      
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------------------------------dgagapetrs
appaspgpfatraatpshvtalrlqalgdelhrramrrrarprdplpallpalrarwlylcaptalaaihge---m----
           lpdanaa                            rlqsfp     athscgpgprcvt--mdl-rwsp
           qlwcfls                            vrr sl     pwr ssgyvpplgaalpgtlspg
            splaiq                                        s   aaqfskdsqrskccqrld
            r    f                                                 f a kdy  m cl
                                                                        v   w a 
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
r----hssypggtepd-g-eeslspfrgrsrsappnl---------------------w-a-r-grelrrmsdefegsfk
-itvv--q--a-p-e-e-m----------------s-asfpagsplgeqppegqflqh-a-q-i------ige-------
g    lr-rq-i-r-rlavtyertavirqlqeeir-ppealg gttqaaggvrveeeerpeiqyaqkntn-a-ninswyt
p    svpl rvaihcgvtyppqrgsyqnfgylledaeala  p qa p vrv     m gveqrarmqclrpqlwetrv
k    at t spmlqafnhqllamlqqhiaeqrvsli                     x  rsaksq asv- dwhrlhe
d    ra s  kscksrppss sprapehespvcqq                      h  kk      ppn kvyaq  
        m    q   mrp  p d lal ndpaaa                                     a  n   
        a         q         d k                                                 
                                                                                

       330       340       350       360       370       380  
....:....|....:....|....:....|....:....|....:....|....:....|..
                                                              
----------------------------a---pqm----llffl------r-----------
rrvgawvyrvpadlkdecaqlrrigdks-gth-l-vqvq----ilqlawr-qlgkggstpsq
gtpfsprsph vs taq raswww pdeqergt-lrmslgwlr-vrswldlneqrpevglwl
lll  ndpk                  dhdpaqsfpilakvtlmiggvvydhpnae me n 
qq   rqte                  vnrdqkdvnlisyfrnpft p n dvps  lc h 
vs   lsen                  qdlqnrerwwwmvn pcqn f p p          
sm   hhvh                  rlqhre pard ss   gl   q            
fh   agqa                  cgiaww  ty  hp   ss                
       l                     c pl  ss   g    p                
© 1998-2022Legal notice