Dataset for protein classical BH3-containing proteins of organism Mus musculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mpgagvfwkqyravcrgllprqlapaavaaaaratashrsplefapffpiecghqapmgtpkqpslapahalglrksdpm
                                                         rvfftldpg epwhhnseaetlg
                                                                               s
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------------------asacd---pglqpalae-----
ararqegsspepveglardmfqipefepseqedgllsadlfaqsqlprpfmakqlspvtvet-regrq-g-setpdqpgr
isspgsmepgqcwreaedssmsserlmartvpg             dc lprgrpmdss---slceg-p-a--raetat 
wmhl  dag rr  p  qmvx eadg  gdmik                rsll gf l-hshgdar-v rwpp--vk s 
                   c                              h    p avkprr   qa pnivqs l p 
                                                          rcc     n  v  s q   l 
                                                            g           t       
                                                                        a       
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------pylapg---s-i---h--------------------------graav---lggag--
lqalgdelhrramrrrarprdpl-----alpg-n-tlpcgnpdgegdrcphgspqgplappasqq-----nsh-----wp
                       qqerv-altqlqyec-                        pttppqtalrhacirde
                       ma l rsvslmam  q                        vvaenpqtaayrnp yr
                        t s  drdrgvw  a                        geqvetrrpffikv rs
                        k p    a we                            mgpf els q  f   l
                                  p                            af    f  l      k
                                                                a               
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------q-p------h-s-pa-t----g--gelspfrgrsrsapen--lw-a-r-g-elrrmsdefegqfk
mglrsrspgprpdam-t-sspmsr-s-y--g-eede-mee-f-alissrt-qep-ed--a-q-y-r-----p-qlnesy-
ldhclsprrgsvlgveprggqfqqaihslvpsyprtlvr-p-r--arilqn---prairswrvitqgawvs-qddp--lt
gprpaafsaytsvlpdlspa alidlerqtvapseqafnhitqsa-----rlrrwqnwspeillapqitliga---dt-f
vyctw a dif fde r l    cskatvqi akcacagmygkrmptvqvqenddfevhqvfeflanhahnrvsnragcg
sl sr         t m e    k rkermr r l riadqahkyhqqnhevsvk  g fk haevr   va nwkqeve
              a          q        p   pxd  dqkalmnppq e          s    kl ciynk a
                                       aa   eg eealng a               h  a t   r
                                             d     m                       a   l
                                             c     i                           h

       330       340       350       360 
....:....|....:....|....:....|....:....|.
                                         
rlv--------------------------------------
pr-rlvdlrtaeqmrqsliwtllrqsfwlrwrgkggstpsq
g-rlpnfyllgtdhplqvglqriillwrdvnlrhpemelnl
-mpfaksagergswyrmaqslffnfiplpddppae vg w 
qwwsigqkvnlrapwyvmynksmgsvtvq qvns  lc h 
vslqeevhshtprklwn spfppvn a n pe r       
s iwwrpdqvpqnvtsd lgh cs                 
n htvqhqirclels   fa   q                 
a agqlcn g d e         l                 
    ka       a                           
© 1998-2022Legal notice