Dataset for protein classical BH3-containing proteins of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

24 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A2AV74_BMF-01           MPGAGVFWKQYRAVCRGLLPRQLAPAAVAAAARATASHRSPLEFAPFFPI
A2AV74_BMF-06           --------------------------------------------------
Q6PEB3_BCL2L11-01       --------------------------------------------------
Q6PEB3_BCL2L11-03       --------------------------------------------------
Q6PEB3_BCL2L11-05       --------------------------------------------------
Q6PEB3_BCL2L11-08       --------------------------------------------------
Q6PEB3_BCL2L11-06       --------------------------------------------------
A0A494BAM9_PMAIP1-      --------------------------------------------------
A0A494BBC4_BAD-07       --------------------------------------------------
A0A2R8VI69_BIK-04       --------------------------------------------------
A0A2R8VI69_BIK-01       --------------------------------------------------
A0A2R8VI69_BIK-02       --------------------------------------------------
A0A2R8VI69_BIK-03       --------------------------------------------------
A2AV74_BMF-02           --------------------------------------------------
B2RVL4_BBC3-01          --------------------------------------------------
A0A494BBC4_BAD-05       --------------------------------------------------
A0A494BBC4_BAD-03       --------------------------------------------------
A0A494BBC4_BAD-04       --------------------------------------------------
A0A494BBC4_BAD-06       --------------------------------------------------
A0A494BBC4_BAD-01       --------------------------------------------------
A0A494BBC4_BAD-02       --------------------------------------------------
A0A494BBC4_BAD-09       --------------------------------------------------
A0A494BAM9_PMAIP1-      --------------------------------------------------
A0A494BAM9_PMAIP1-      --------------------------------------------------
                                                                          

A2AV74_BMF-01           ECGHQAPRVFFTLDPGAEPWHHNSEAETLSWSHPGEMEPPQCVEELEDDV
A2AV74_BMF-06           ------------------------------------MEPPQCVEELEDDV
Q6PEB3_BCL2L11-01       --------------------------------------------------
Q6PEB3_BCL2L11-03       --------------------------------------------------
Q6PEB3_BCL2L11-05       --------------------------------------------------
Q6PEB3_BCL2L11-08       --------------------------------------------------
Q6PEB3_BCL2L11-06       --------------------------------------------------
A0A494BAM9_PMAIP1-      --------------------------------------------------
A0A494BBC4_BAD-07       --------------------------------------------------
A0A2R8VI69_BIK-04       --------------------------------------------------
A0A2R8VI69_BIK-01       --------------------------------------------------
A0A2R8VI69_BIK-02       --------------------------------------------------
A0A2R8VI69_BIK-03       --------------------------------------------------
A2AV74_BMF-02           -------------------------------MSPGEMEPPQCVEELEDDV
B2RVL4_BBC3-01          -------MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPG
A0A494BBC4_BAD-05       -------------------------------------------------M
A0A494BBC4_BAD-03       -------------------------------------------------M
A0A494BBC4_BAD-04       -------------------------------------------------M
A0A494BBC4_BAD-06       -------------------------------------------------M
A0A494BBC4_BAD-01       -------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSM
A0A494BBC4_BAD-02       -------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSM
A0A494BBC4_BAD-09       --------------------------------------------------
A0A494BAM9_PMAIP1-      --------------------------------------------------
A0A494BAM9_PMAIP1-      --------------------------------------------------
                                                                          

A2AV74_BMF-01           FQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPIS
A2AV74_BMF-06           FQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPIS
Q6PEB3_BCL2L11-01       ------MAKQPSD-------------------------VSSECDREGGQL
Q6PEB3_BCL2L11-03       ------MAKQPSD-------------------------VSSECDREGGQL
Q6PEB3_BCL2L11-05       ------MAKQPSD-------------------------VSSECDREGGQL
Q6PEB3_BCL2L11-08       ------MAKQPSD-------------------------VSSECDREGGQL
Q6PEB3_BCL2L11-06       ------MAKQPSD-------------------------VSSECDREGGQL
A0A494BAM9_PMAIP1-      ---------MPGR-------------------------KARRNAPVNPTR
A0A494BBC4_BAD-07       XQIPEFEPSEQED-------------------------ASATDRGLGPSL
A0A2R8VI69_BIK-04       --------------------------------------------------
A0A2R8VI69_BIK-01       MSEARLMARDVIK-------------------------TVPHDQVPQPPV
A0A2R8VI69_BIK-02       MSEARLMARDVIK-------------------------TVPHDQVPQPPV
A0A2R8VI69_BIK-03       MSEARLMARDVIK-------------------------TVPHDQVPQPPV
A2AV74_BMF-02           FQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPIS
B2RVL4_BBC3-01          LPAAPAAPALLPA-------------------------AYLCAPTAPPAV
A0A494BBC4_BAD-05       FQIPEFEPSEQED-------------------------ASATDRGLGPSL
A0A494BBC4_BAD-03       FQIPEFEPSEQED-------------------------ASATDRGLGPSL
A0A494BBC4_BAD-04       FQIPEFEPSEQED-------------------------ASATDRGLGPSL
A0A494BBC4_BAD-06       FQIPEFEPSEQED-------------------------ASATDRGLGPSL
A0A494BBC4_BAD-01       FQIPEFEPSEQED-------------------------ASATDRGLGPSL
A0A494BBC4_BAD-02       FQIPEFEPSEQED-------------------------ASATDRGLGPSL
A0A494BBC4_BAD-09       --------------------------------------------------
A0A494BAM9_PMAIP1-      --------------------------------------------------
A0A494BAM9_PMAIP1-      --------------------------------------------------
                                                                          

A2AV74_BMF-01           QEDKATQTLSPASP-SQGVMLPCGVTEEPQRLFYGNAG------------
A2AV74_BMF-06           QEDKATQTLSPASP-SQGVMLPCGVTEEPQRLFYGNAG------------
Q6PEB3_BCL2L11-01       QPAERPPQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPLAPPASPGPF
Q6PEB3_BCL2L11-03       QPAERPPQLRPGAPTSLQTEPQ----------------------------
Q6PEB3_BCL2L11-05       QPAERPPQLRPGAPTSLQTEPQ----------------------------
Q6PEB3_BCL2L11-08       QPAERPPQLRPGAPTSLQTEPQ----------------------------
Q6PEB3_BCL2L11-06       QPAERPPQLRPGAPTSLQTEPQ----------------------------
A0A494BAM9_PMAIP1-      AELPPEFAAQLRKIGDKVYCTWSAPDITVVLAQMPG--------------
A0A494BBC4_BAD-07       TEDQPGPYLAPGLL-GSNIHQQGRAATNSHHGGAGAME------------
A0A2R8VI69_BIK-04       --------------------MFTRNQVALRLACIGD--------------
A0A2R8VI69_BIK-01       ASETPSMKEPVRDV-DLMECVEGRNQVALRLACIGD--------------
A0A2R8VI69_BIK-02       ASETPSMKEPVRDV-DLMECVEGRNQVALRLACIGD--------------
A0A2R8VI69_BIK-03       ASETPSMKEPVRDV-DLMECVEGRNQVALRLACIGD--------------
A2AV74_BMF-02           QEDKATQTLSPASP-SQGVMLPCGVTEEPQRLFYGNAG------------
B2RVL4_BBC3-01          TAALGGPRWPGG--------HRSRPRGPRPDGPQPSLS------------
A0A494BBC4_BAD-05       TEDQPGPYLAPGLL-GSNIHQQGRAATNSHHGGAGAME------------
A0A494BBC4_BAD-03       TEDQPGPYLAPGLL-GSNIHQQGRAATNSHHGGAGAME------------
A0A494BBC4_BAD-04       TEDQPGPYLAPGLL-GSNIHQQGRAATNSHHGGAGAME------------
A0A494BBC4_BAD-06       TEDQPGPYLAPGLL-GSNIHQQGRAATNSHHGGAGAME------------
A0A494BBC4_BAD-01       TEDQPGPYLAPGLL-GSNIHQQGRAATNSHHGGAGAME------------
A0A494BBC4_BAD-02       TEDQPGPYLAPGLL-GSNIHQQGRAATNSHHGGAGAME------------
A0A494BBC4_BAD-09       --------------------------------------------------
A0A494BAM9_PMAIP1-      --------------------------------------------------
A0A494BAM9_PMAIP1-      --------------------------------------------------
                                                                          

A2AV74_BMF-01           ----------------------------YRLPLPASFPAGSPLGEQPPEG
A2AV74_BMF-06           ----------------------------YRLPLPASFPAGSPLGEQPPEG
Q6PEB3_BCL2L11-01       ATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
Q6PEB3_BCL2L11-03       ----------------------------DRSPAPMSCDKSTQTPSPPCQA
Q6PEB3_BCL2L11-05       ----------------------------DRSPAPMSCDKSTQTPSPPCQA
Q6PEB3_BCL2L11-08       --------------------------------------------------
Q6PEB3_BCL2L11-06       --------------------------------------------------
A0A494BAM9_PMAIP1-      ----------------------------------------------KSQK
A0A494BBC4_BAD-07       ----------------------------TR-SRHSSYPAGTEEDEGMEEE
A0A2R8VI69_BIK-04       -----------------------------------------------EMD
A0A2R8VI69_BIK-01       -----------------------------------------------EMD
A0A2R8VI69_BIK-02       -----------------------------------------------EMD
A0A2R8VI69_BIK-03       -----------------------------------------------EMD
A2AV74_BMF-02           ----------------------------YRLPLPASFPAGSPLGEQ----
B2RVL4_BBC3-01          ----------------------------PA-QQHLESPVPSAPE------
A0A494BBC4_BAD-05       ----------------------------TR-SRHSSYPAGTEEDEGMEEE
A0A494BBC4_BAD-03       ----------------------------TR-SRHSSYPAGTEEDEGMEEE
A0A494BBC4_BAD-04       ----------------------------TR-SRHSSYPAGTEEDEGMEEE
A0A494BBC4_BAD-06       ----------------------------TR-SRHSSYPAGTEEDEGMEEE
A0A494BBC4_BAD-01       ----------------------------TR-SRHSSYPAGTEEDEGMEEE
A0A494BBC4_BAD-02       ----------------------------TR-SRHSSYPAGTEEDEGMEEE
A0A494BBC4_BAD-09       --------------------------------------------------
A0A494BAM9_PMAIP1-      --------------------------------------------------
A0A494BAM9_PMAIP1-      --------------------------------------------------
                                                                          

A2AV74_BMF-01           QFLQH----------------RAEVQIARKLQCIADQFHRLHTQQ-----
A2AV74_BMF-06           QFLQH----------------RAEVQIARKLQCIADQFHRLHTQQ-----
Q6PEB3_BCL2L11-01       FNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFAND
Q6PEB3_BCL2L11-03       FNHYLSAMDQLENLNQVAQNIH------------GDAWYN----------
Q6PEB3_BCL2L11-05       FNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFAND
Q6PEB3_BCL2L11-08       --------ASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFAND
Q6PEB3_BCL2L11-06       --------ASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFAND
A0A494BAM9_PMAIP1-      SRMRSPSPTRVP----------------ADLKDECAQLRRIGDKVNLRQK
A0A494BBC4_BAD-07       LSPFRGRSRSAPPNL------WAAQRYGRELRRMSDEFE-----GSFKSM
A0A2R8VI69_BIK-04       LCLRSPRLVQLP---------------GIAIHRLAVTYSRTGVRGIFRSL
A0A2R8VI69_BIK-01       LCLRSPRLVQLP---------------GIAIHRLAVTYSRTGVRGIFRSL
A0A2R8VI69_BIK-02       LCLRSPRLVQLP---------------GIAIHRLAVTYSRTGVRGIFRSL
A0A2R8VI69_BIK-03       LCLRSPRLVQLP---------------GIAIHRLAVTYSRTGVRGIFRSL
A2AV74_BMF-02           --PPEGQFLQHRAEV----------QIARKLQCIADQFHRLHTQQ-----
B2RVL4_BBC3-01          --ALAGGPTQAAPGVRVEEEEW-AREIGAQLRRMADDLNAQYERRRQE--
A0A494BBC4_BAD-05       LSPFRGRSRSAPPNL------WAAQRYGRELRRMSDEFEGSFKVSASVRC
A0A494BBC4_BAD-03       LSPFRGRSRSAPPNL------WAAQRYGRELRRMSDEFEGSFKGLPRPKS
A0A494BBC4_BAD-04       LSPFRGRSRSAPPNL------WAAQRYGRELRRMSDEFEGSFKGLPRPKS
A0A494BBC4_BAD-06       LSPFRGRSRSAPPNL------WAAQRYGRELRRMSDEFEGSFKGLPRPKS
A0A494BBC4_BAD-01       LSPFRGRSRSAPPNL------WAAQRYGRELRRMSDEFEGSFKGLPRPKS
A0A494BBC4_BAD-02       LSPFRGRSRSAPPNL------WAAQRYGRELRRMSDEFEGSFKG------
A0A494BBC4_BAD-09       ---------------------XAAQRYGRELRRMSDEFEGSFKFHLGSRH
A0A494BAM9_PMAIP1-      ---------------------MPGRKAR-RNAPVNP--------------
A0A494BAM9_PMAIP1-      ---------------------MPGKSQKSRMRSPSP--------------
                                                                          

A2AV74_BMF-01           ----HQQNRDRAWWQVF--------------LFLQNLALNRQENREGVGP
A2AV74_BMF-06           ----HQQNRDRAWWQVF--------------LFLQNLALNRQENREGVGP
Q6PEB3_BCL2L11-01       YREAEDHPQMVILQLLRFIFRLVWRRH-----------------------
Q6PEB3_BCL2L11-03       --------------------------------------------------
Q6PEB3_BCL2L11-05       YREAEDHPQMVILQLLRFIFRLVWRRH-----------------------
Q6PEB3_BCL2L11-08       YREAEDHPQMVILQLLRFIFRLVWRRH-----------------------
Q6PEB3_BCL2L11-06       YREAEDHPQMVILQLLRFIFRLVWRRH-----------------------
A0A494BAM9_PMAIP1-      LLNLIS------------------------KLFNLVT-------------
A0A494BBC4_BAD-07       LGLAVLIRPLSVSSDLLGFPPSSSFVQDPVPSPGLCLHL-----------
A0A2R8VI69_BIK-04       IRSLTNLRENIWSWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQ
A0A2R8VI69_BIK-01       IRSLTNLRENIWSWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQ
A0A2R8VI69_BIK-02       IRSLTNLRENIWSWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQ
A0A2R8VI69_BIK-03       IRSLTNLRENIWSWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGG-----
A2AV74_BMF-02           ----HQQNRDRAWWQVF--------------LFLQNLALNRQENREGVGP
B2RVL4_BBC3-01          ----EQHRHRPSPWRVMY------------NLFMGLLPLPRDPGAPEMEP
A0A494BBC4_BAD-05       DGT-----------------------------------------------
A0A494BBC4_BAD-03       AGTATQMRQSAGWTRIIQ------------SWW------DRNLGKGGSTP
A0A494BBC4_BAD-04       AGTATQMRQSAGWTRIIQ------------SWW------DRNLGKGGSTP
A0A494BBC4_BAD-06       AGTATQMRQSAGWTRIIQ------------SWW------DRNLGKGGSTP
A0A494BBC4_BAD-01       AGTATQMRQSAGWTRIIQ------------SWW------DRNLGKGGSTP
A0A494BBC4_BAD-02       ----EELTYSLSPFRCVQ--------------------------------
A0A494BBC4_BAD-09       THHPVSLTAQCRASWWWGPDSGCQNE-----AHSFLLLP-----------
A0A494BAM9_PMAIP1-      TR--ADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT-----------
A0A494BAM9_PMAIP1-      TRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT-----------
                                                                          

A2AV74_BMF-01           W-
A2AV74_BMF-06           W-
Q6PEB3_BCL2L11-01       --
Q6PEB3_BCL2L11-03       --
Q6PEB3_BCL2L11-05       --
Q6PEB3_BCL2L11-08       --
Q6PEB3_BCL2L11-06       --
A0A494BAM9_PMAIP1-      --
A0A494BBC4_BAD-07       --
A0A2R8VI69_BIK-04       LQ
A0A2R8VI69_BIK-01       LQ
A0A2R8VI69_BIK-02       LQ
A0A2R8VI69_BIK-03       --
A2AV74_BMF-02           W-
B2RVL4_BBC3-01          N-
A0A494BBC4_BAD-05       --
A0A494BBC4_BAD-03       SQ
A0A494BBC4_BAD-04       SQ
A0A494BBC4_BAD-06       SQ
A0A494BBC4_BAD-01       SQ
A0A494BBC4_BAD-02       --
A0A494BBC4_BAD-09       --
A0A494BAM9_PMAIP1-      --
A0A494BAM9_PMAIP1-      --
                          

© 1998-2023Legal notice