Dataset for protein classical BH3-containing proteins of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q9JM54_PMAIP1-03       --------------------------------------------------
A2AV74_BMF-01          MPGAGVFWKQYRAVCRGLLPRQLAPAAVAAAARATASHRSPLEFAPFFPI
Q9JM54_PMAIP1-01       --------------------------------------------------
O70337_BIK-04          --------------------------------------------------
O70337_BIK-02          --------------------------------------------------
O70337_BIK-01          --------------------------------------------------
O54918_BCL2L11-03      --------------------------------------------------
P62816_HRK-03          --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
A2AV74_BMF-02          --------------------------------------------------
Q99ML1_BBC3-02         --------------------------------------------------
O54918_BCL2L11-01      --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
                                                                         

Q9JM54_PMAIP1-03       --------------------------------------------------
A2AV74_BMF-01          ECGHQAPRVFFTLDPGAEPWHHNSEAETLSWSHPGEMEPPQCVEELED--
Q9JM54_PMAIP1-01       --------------------------------------------------
O70337_BIK-04          --------------------------------------------------
O70337_BIK-02          --------------------------------------------------
O70337_BIK-01          --------------------------------------------------
O54918_BCL2L11-03      --------------------------------------------------
P62816_HRK-03          --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
A2AV74_BMF-02          -------------------------------MSPGEMEPPQCVEELED--
Q99ML1_BBC3-02         -----------------------------MARARQEGSSPEPVEGLAR--
O54918_BCL2L11-01      -------------------------------MAKQPSDVSS------ECD
Q61337_BAD-01          -----------------------------MGTPKQPSLAPAHALGLRKSD
                                                                         

Q9JM54_PMAIP1-03       --------------------------------------------------
A2AV74_BMF-01          ---DVFQSEDGEPGTQPGGLLSADL----FAQSQLDCPLSRLQLFPLTHC
Q9JM54_PMAIP1-01       -------------------------MPGRKARRNAPVNPTRAELPP----
O70337_BIK-04          --------------------------------------------------
O70337_BIK-02          ---------------MSEARLMARDVIKTVPHDQVPQPPVASETPSMKEP
O70337_BIK-01          ---------------MSEARLMARDVIKTVPHDQVPQPPVASETPSMKEP
O54918_BCL2L11-03      -------------------------MAKQPSDVSSECDREGGQLQPA---
P62816_HRK-03          ---------------------------------MCPCPRHRGRGPPAVCG
Q61337_BAD-05          ---------------------MFQI-PEFEPSEQEDASATDRGLGPSLTE
A2AV74_BMF-02          ---DVFQSEDGEPGTQPGGLLSADL----FAQSQLDCPLSRLQLFPLTHC
Q99ML1_BBC3-02         ---D-------SPRPFPLGRLMPSAVSCSLCEPGLPAAPAAPALLPAAYL
O54918_BCL2L11-01      REGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPLAPP
Q61337_BAD-01          PGIRSLGSDAGGRRWRPAAQSMFQI-PEFEPSEQEDASATDRGLGPSLTE
                                                                         

Q9JM54_PMAIP1-03       ------------------------------------------MPGKSQKS
A2AV74_BMF-01          CGPG--------------LRPISQEDKATQTLSPASPSQGVMLPCGVTEE
Q9JM54_PMAIP1-01       --------------EFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKS
O70337_BIK-04          ---------MFTRNQVALRLACIGDEMDLCLRSPR----LVQLPGIAIHR
O70337_BIK-02          VRDVDLMECVEGRNQVALRLACIGDEMDLCLRSPR----LVQLPGIAIHR
O70337_BIK-01          VRDVDLMECVEGRNQVALRLACIGDEMDLCLRSPR----LVQLPGIAIHR
O54918_BCL2L11-03      --ERPPQLRPGAPT----------------SLQTE---------------
P62816_HRK-03          CGDARPGLRWAAAQVTALRLQALGDELHRRAMRRR---------------
Q61337_BAD-05          DQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEED
A2AV74_BMF-02          CGPG--------------LRPISQEDKATQTLSPASPSQGVMLPCGVTEE
Q99ML1_BBC3-02         CAPT--------------APPAVTAALG----GPRWPGGHRSRPRGPRPD
O54918_BCL2L11-01      ASPGPFATRSPLFIFVRRSSLLSRSS----SGYFSFDTDRSPAPMSCDKS
Q61337_BAD-01          DQPGPYLAPGLLGSNIHQQGRAATNSHHGGAGAMETRSRHSSYPAGTEED
                                                                         

Q9JM54_PMAIP1-03       ----------------------RMRSPSPTRVPA-------DLKDECAQL
A2AV74_BMF-01          PQRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQF-------LQHRAEVQI
Q9JM54_PMAIP1-01       ----------------------RMRSPSPTRVPA-------DLKDECAQL
O70337_BIK-04          ----------------------LAVTYSRTGVRG-------IFRSLIRSL
O70337_BIK-02          ----------------------LAVTYSRTGVRG-------IFRSLIRSL
O70337_BIK-01          ----------------------LAVTYSRTGVRG-------IFRSLIRSL
O54918_BCL2L11-03      -------------------------PQDRSPAPM-------SCDKSTQTP
P62816_HRK-03          -------------------------ARPRDPLP---------------AL
Q61337_BAD-05          --------EGMEEELSPFRG--RSRSAPPNLWAA---------QRYGREL
A2AV74_BMF-02          PQRLFYGNAGYRLPLPASFP----AGSPLGEQPP---EGQFLQHRAEVQI
Q99ML1_BBC3-02         GPQPSLSPAQQHLESPVPSAPEALAGGPTQAAPGVRVEEEEWAREIGAQL
O54918_BCL2L11-01      TQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPE---------IRIAQEL
Q61337_BAD-01          --------EGMEEELSPFRG--RSRSAPPNLWAA---------QRYGREL
                                                                         

Q9JM54_PMAIP1-03       RRIGDKV---------------NLRQKLLNLISKLFNLVT----------
A2AV74_BMF-01          ARKLQCIADQFHRLHT----QQHQQNRDRAWWQVFLFLQNLALNRQENRE
Q9JM54_PMAIP1-01       RRIGDKV---------------NLRQKLLNLISKLFNLVT----------
O70337_BIK-04          TNLRENIWSWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ--
O70337_BIK-02          TNLRENIWSWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ--
O70337_BIK-01          TNLRENIWSWRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ--
O54918_BCL2L11-03      SPPCQAFNHYL-----------SAMDQLENLNQVAQNIHGDAWYN-----
P62816_HRK-03          LPALRARWPWL-----------CAAAQVAALA---------AWLLGRRSA
Q61337_BAD-05          RRMSDEFEGSFKVSASV---RCDGT-------------------------
A2AV74_BMF-02          ARKLQCIADQFHRLHTQ---QHQQNRDRAWWQVF-LFLQNLALNRQENRE
Q99ML1_BBC3-02         RRMADDLNAQYERRRQE---EQHRHRPSPWRVMYNLFMGLLPLPRDPGAP
O54918_BCL2L11-01      RRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH----
Q61337_BAD-01          RRMSDEFEGSFKGLPRP---KSAGTATQMRQSAGWTRIIQSWWDRNLGKG
                                                                         

Q9JM54_PMAIP1-03       ------
A2AV74_BMF-01          GVGPW-
Q9JM54_PMAIP1-01       ------
O70337_BIK-04          ------
O70337_BIK-02          ------
O70337_BIK-01          ------
O54918_BCL2L11-03      ------
P62816_HRK-03          ------
Q61337_BAD-05          ------
A2AV74_BMF-02          GVGPW-
Q99ML1_BBC3-02         EMEPN-
O54918_BCL2L11-01      ------
Q61337_BAD-01          GSTPSQ
                             

© 1998-2020Legal notice