Dataset for protein classical BH3-containing proteins of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

28 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


O54918_BCL2L11-01      --------------------------------------------------
O54918_BCL2L11-03      --------------------------------------------------
O54918_BCL2L11-05      --------------------------------------------------
O54918_BCL2L11-08      --------------------------------------------------
O54918_BCL2L11-06      --------------------------------------------------
Q91ZE9_BMF-02          --------------------------------------------------
P62816_HRK-03          --------------------------------------------------
Q99ML1_BBC3-01         --------------------------------------------------
Q99ML1_BBC3-03         --------------------------------------------------
B2RVL4_BBC3-01         --------------------------------------------------
Q99ML1_BBC3-02         --------------------------------------------------
Q91ZE9_BMF-06          --------------------------------------------------
Q91ZE9_BMF-01          MPGAGVFWKQYRAVCRGLLPRQLAPAAVAAAARATASHRSPLEFAPFFPI
Q61337_BAD-07          --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-02          --------------------------------------------------
Q61337_BAD-01          --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
Q9JM54_PMAIP1-01       --------------------------------------------------
O70337_BIK-04          --------------------------------------------------
O70337_BIK-03          --------------------------------------------------
O70337_BIK-01          --------------------------------------------------
O70337_BIK-02          --------------------------------------------------
Q61337_BAD-09          --------------------------------------------------
Q9JM54_PMAIP1-03       --------------------------------------------------
Q9JM54_PMAIP1-02       --------------------------------------------------
                                                                         

O54918_BCL2L11-01      --------------------------------------------------
O54918_BCL2L11-03      --------------------------------------------------
O54918_BCL2L11-05      --------------------------------------------------
O54918_BCL2L11-08      --------------------------------------------------
O54918_BCL2L11-06      --------------------------------------------------
Q91ZE9_BMF-02          -------------------------------MSPGEMEPPQCVEELEDDV
P62816_HRK-03          ------------------------------------------------MC
Q99ML1_BBC3-01         -----------------------------MARARQEGSSPEPVEGLARDS
Q99ML1_BBC3-03         -----------------------------MARARQEGSSPEPVEGLARDS
B2RVL4_BBC3-01         -----------------------------MARARQEGSSPEPVEGLARDS
Q99ML1_BBC3-02         -----------------------------MARARQEGSSPEPVEGLARDS
Q91ZE9_BMF-06          ------------------------------------MEPPQCVEELEDDV
Q91ZE9_BMF-01          ECGHQAPRVFFTLDPGAEPWHHNSEAETLSWSHPGEMEPPQCVEELEDDV
Q61337_BAD-07          --------------------------------------------------
Q61337_BAD-05          -------------------------------------------------M
Q61337_BAD-02          -------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSM
Q61337_BAD-01          -------MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSM
Q61337_BAD-04          -------------------------------------------------M
Q61337_BAD-06          -------------------------------------------------M
Q61337_BAD-03          -------------------------------------------------M
Q9JM54_PMAIP1-01       --------------------------------------------------
O70337_BIK-04          --------------------------------------------------
O70337_BIK-03          --------------------------------------------------
O70337_BIK-01          --------------------------------------------------
O70337_BIK-02          --------------------------------------------------
Q61337_BAD-09          --------------------------------------------------
Q9JM54_PMAIP1-03       --------------------------------------------------
Q9JM54_PMAIP1-02       --------------------------------------------------
                                                                         

O54918_BCL2L11-01      ------------------------------MAKQPSDVSSECDREGGQLQ
O54918_BCL2L11-03      ------------------------------MAKQPSDVSSECDREGGQLQ
O54918_BCL2L11-05      ------------------------------MAKQPSDVSSECDREGGQLQ
O54918_BCL2L11-08      ------------------------------MAKQPSDVSSECDREGGQLQ
O54918_BCL2L11-06      ------------------------------MAKQPSDVSSECDREGGQLQ
Q91ZE9_BMF-02          FQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCG---PGLR
P62816_HRK-03          --------------------------PCPRHRGRGPPAVCGCGDARPGLR
Q99ML1_BBC3-01         --------------------------PRPFPLGRLMPSAVSCSLCEPGLP
Q99ML1_BBC3-03         --------------------------PRPFPLGRLMPSAVSCSLCEPGLP
B2RVL4_BBC3-01         --------------------------PRPFPLGRLMPSAVSCSLCEPGLP
Q99ML1_BBC3-02         --------------------------PRPFPLGRLMPSAVSCSLCEPGLP
Q91ZE9_BMF-06          FQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCG---PGLR
Q91ZE9_BMF-01          FQSEDGEPGTQPGGLLSADLFAQSQLDCPLSRLQLFPLTHCCG---PGLR
Q61337_BAD-07          XQIPEFEPSEQED-------------------------ASATD---RGLG
Q61337_BAD-05          FQIPEFEPSEQED-------------------------ASATD---RGLG
Q61337_BAD-02          FQIPEFEPSEQED-------------------------ASATD---RGLG
Q61337_BAD-01          FQIPEFEPSEQED-------------------------ASATD---RGLG
Q61337_BAD-04          FQIPEFEPSEQED-------------------------ASATD---RGLG
Q61337_BAD-06          FQIPEFEPSEQED-------------------------ASATD---RGLG
Q61337_BAD-03          FQIPEFEPSEQED-------------------------ASATD---RGLG
Q9JM54_PMAIP1-01       ----------MPG-------------------------RKARR---NAPV
O70337_BIK-04          --------------------------------------------------
O70337_BIK-03          MSEARLMARDVIK-------------------------TVPHD---QVPQ
O70337_BIK-01          MSEARLMARDVIK-------------------------TVPHD---QVPQ
O70337_BIK-02          MSEARLMARDVIK-------------------------TVPHD---QVPQ
Q61337_BAD-09          --------------------------------------------------
Q9JM54_PMAIP1-03       --------------------------------------------------
Q9JM54_PMAIP1-02       --------------------------------------------------
                                                                         

O54918_BCL2L11-01      PAERP----------------------------PQLRPGAPTSLQTEPQG
O54918_BCL2L11-03      PAERP----------------------------PQLRPGAPTSLQTEPQ-
O54918_BCL2L11-05      PAERP----------------------------PQLRPGAPTSLQTEPQ-
O54918_BCL2L11-08      PAERP----------------------------PQLRPGAPTSLQTEPQ-
O54918_BCL2L11-06      PAERP----------------------------PQLRPGAPTSLQTEPQ-
Q91ZE9_BMF-02          PISQEDKAT------------------------QTLSPASPSQGVMLPC-
P62816_HRK-03          WAAAQVTALRLQALGDELHRRAMRRRARPRDPLPALLPALRARWPWLCA-
Q99ML1_BBC3-01         AAPAA----------------------------PALLPA-----AYLCA-
Q99ML1_BBC3-03         AAPAA----------------------------PALLPA-----AYLCA-
B2RVL4_BBC3-01         AAPAA----------------------------PALLPA-----AYLCA-
Q99ML1_BBC3-02         AAPAA----------------------------PALLPA-----AYLCA-
Q91ZE9_BMF-06          PISQEDKAT------------------------QTLSPASPSQGVMLPC-
Q91ZE9_BMF-01          PISQEDKAT------------------------QTLSPASPSQGVMLPC-
Q61337_BAD-07          PSLTEDQPG------------------------PYLAPGLLGSNI---H-
Q61337_BAD-05          PSLTEDQPG------------------------PYLAPGLLGSNI---H-
Q61337_BAD-02          PSLTEDQPG------------------------PYLAPGLLGSNI---H-
Q61337_BAD-01          PSLTEDQPG------------------------PYLAPGLLGSNI---H-
Q61337_BAD-04          PSLTEDQPG------------------------PYLAPGLLGSNI---H-
Q61337_BAD-06          PSLTEDQPG------------------------PYLAPGLLGSNI---H-
Q61337_BAD-03          PSLTEDQPG------------------------PYLAPGLLGSNI---H-
Q9JM54_PMAIP1-01       NPTRAELPP-----------------------------------------
O70337_BIK-04          --------------------------------------------------
O70337_BIK-03          PPVASETPS------------------------MKEPVRDVDLME---C-
O70337_BIK-01          PPVASETPS------------------------MKEPVRDVDLME---C-
O70337_BIK-02          PPVASETPS------------------------MKEPVRDVDLME---C-
Q61337_BAD-09          --------------------------------------------------
Q9JM54_PMAIP1-03       --------------------------------------------------
Q9JM54_PMAIP1-02       --------------------------------------------------
                                                                         

O54918_BCL2L11-01      NPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGY
O54918_BCL2L11-03      --------------------------------------------------
O54918_BCL2L11-05      --------------------------------------------------
O54918_BCL2L11-08      --------------------------------------------------
O54918_BCL2L11-06      --------------------------------------------------
Q91ZE9_BMF-02          -----------------------GVTEEPQRLFYGNAGYRLPLPASFPAG
P62816_HRK-03          -----------------------AAQVAALAA------WLLGRRSA----
Q99ML1_BBC3-01         -----------------------PTAPPAVTAALGGPRWPGGHRSRPRGP
Q99ML1_BBC3-03         -----------------------PTAPPAVTAALGGPRWPGGHRSRPRGP
B2RVL4_BBC3-01         -----------------------PTAPPAVTAALGGPRWPGGHRSRPRGP
Q99ML1_BBC3-02         -----------------------PTAPPAVTAALGGPRWPGGHRSRPRGP
Q91ZE9_BMF-06          -----------------------GVTEEPQRLFYGNAGYRLPLPASFPAG
Q91ZE9_BMF-01          -----------------------GVTEEPQRLFYGNAGYRLPLPASFPAG
Q61337_BAD-07          -----------------------QQGRAATNSHHGGAG------------
Q61337_BAD-05          -----------------------QQGRAATNSHHGGAG------------
Q61337_BAD-02          -----------------------QQGRAATNSHHGGAG------------
Q61337_BAD-01          -----------------------QQGRAATNSHHGGAG------------
Q61337_BAD-04          -----------------------QQGRAATNSHHGGAG------------
Q61337_BAD-06          -----------------------QQGRAATNSHHGGAG------------
Q61337_BAD-03          -----------------------QQGRAATNSHHGGAG------------
Q9JM54_PMAIP1-01       ----------------------------EFAAQLRKIGDKVYCTWSAPDI
O70337_BIK-04          -----------------------MFTRNQVALRLACIGDEMDLCLRSPR-
O70337_BIK-03          -----------------------VEGRNQVALRLACIGDEMDLCLRSPR-
O70337_BIK-01          -----------------------VEGRNQVALRLACIGDEMDLCLRSPR-
O70337_BIK-02          -----------------------VEGRNQVALRLACIGDEMDLCLRSPR-
Q61337_BAD-09          --------------------------------------------------
Q9JM54_PMAIP1-03       --------------------------------------------------
Q9JM54_PMAIP1-02       --------------------------------------------------
                                                                         

O54918_BCL2L11-01      FSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRP
O54918_BCL2L11-03      -----DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDQLENLNQVAQNIH-
O54918_BCL2L11-05      -----DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRP
O54918_BCL2L11-08      -----------------------------------ASIRQSQEEPEDLRP
O54918_BCL2L11-06      -----------------------------------ASIRQSQEEPEDLRP
Q91ZE9_BMF-02          SPLGEQPPEGQFLQH-----------------------------------
P62816_HRK-03          --------------------------------------------------
Q99ML1_BBC3-01         RPD-----------------------------------------------
Q99ML1_BBC3-03         RPDGPQPSLSPAQQHLESPVPSAPEALAGGPTQAAPGVRV----------
B2RVL4_BBC3-01         RPDGPQPSLSPAQQHLESPVPSAPEALAGGPTQAAPGVRVEEEEW-----
Q99ML1_BBC3-02         RPDGPQPSLSPAQQHLESPVPSAPEALAGGPTQAAPGVRVEEEEW-----
Q91ZE9_BMF-06          SPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQQNRDRAWWQ
Q91ZE9_BMF-01          SPLGEQPPEGQFLQHRAEVQIARKLQCIADQFHRLHTQQHQQNRDRAWWQ
Q61337_BAD-07          ---AMETRS----RHSSYPAGTEEDEGMEEELSPFRGRSRSAPPN--LWA
Q61337_BAD-05          ---AMETRS----RHSSYPAGTEEDEGMEEELSPFRGRSRSAPPN--LWA
Q61337_BAD-02          ---AMETRS----RHSSYPAGTEEDEGMEEELSPFRGRSRSAPPN--LWA
Q61337_BAD-01          ---AMETRS----RHSSYPAGTEEDEGMEEELSPFRGRSRSAPPN--LWA
Q61337_BAD-04          ---AMETRS----RHSSYPAGTEEDEGMEEELSPFRGRSRSAPPN--LWA
Q61337_BAD-06          ---AMETRS----RHSSYPAGTEEDEGMEEELSPFRGRSRSAPPN--LWA
Q61337_BAD-03          ---AMETRS----RHSSYPAGTEEDEGMEEELSPFRGRSRSAPPN--LWA
Q9JM54_PMAIP1-01       TVVLAQMPG----KSQKSRMRSPSPTRVPADLKDECAQLRRIGDK--V--
O70337_BIK-04          ---LVQLPG----IAIHRLAVTYSRTGVRGIFRSLIRSLTNLREN--IWS
O70337_BIK-03          ---LVQLPG----IAIHRLAVTYSRTGVRGIFRSLIRSLTNLREN--IWS
O70337_BIK-01          ---LVQLPG----IAIHRLAVTYSRTGVRGIFRSLIRSLTNLREN--IWS
O70337_BIK-02          ---LVQLPG----IAIHRLAVTYSRTGVRGIFRSLIRSLTNLREN--IWS
Q61337_BAD-09          -----------------------------XAAQRYGRELRRMSDEFEGSF
Q9JM54_PMAIP1-03       -----------------------------MPGKSQKSRMRSPSP------
Q9JM54_PMAIP1-02       -----------------------------MPGRKAR-RNAPVNP------
                                                                         

O54918_BCL2L11-01      EIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLV
O54918_BCL2L11-03      -----------GDAWYN---------------------------------
O54918_BCL2L11-05      EIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLV
O54918_BCL2L11-08      EIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLV
O54918_BCL2L11-06      EIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLV
Q91ZE9_BMF-02          --RAEVQIARKLQCIADQFHRLHTQQHQQNRDRAWWQVF-LFLQNLALNR
P62816_HRK-03          --------------------------------------------------
Q99ML1_BBC3-01         --------------------------------------------------
Q99ML1_BBC3-03         --------------------------------------------------
B2RVL4_BBC3-01         AREIGAQLRRMADDLNAQYERRRQEEQHRHRPSPWRVMYNLFMGLLPLPR
Q99ML1_BBC3-02         AREIGAQLRRMADDLNAQYERRRQEEQHRHRPSPWRVMYNLFMGLLPLPR
Q91ZE9_BMF-06          VFLFLQNLALNRQENREGVGPW----------------------------
Q91ZE9_BMF-01          VFLFLQNLALNRQENREGVGPW----------------------------
Q61337_BAD-07          AQRYGRELRRMSDEFEGSFKSMLGLAVLIRPLSVSSDLLGFPPSSSFVQD
Q61337_BAD-05          AQRYGRELRRMSDEFEGSFKVSASVRCDGT--------------------
Q61337_BAD-02          AQRYGRELRRMSDEFEGSFKG----------EELTYSLSPFRCVQ-----
Q61337_BAD-01          AQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQSAGWTRIIQSWWDR
Q61337_BAD-04          AQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQSAGWTRIIQSWWDR
Q61337_BAD-06          AQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQSAGWTRIIQSWWDR
Q61337_BAD-03          AQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQSAGWTRIIQSWWDR
Q9JM54_PMAIP1-01       -------------NLRQKLLNLISKLFNLVT-------------------
O70337_BIK-04          WRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ-----------
O70337_BIK-03          WRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGG------------------
O70337_BIK-01          WRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ-----------
O70337_BIK-02          WRVLTPGAWVSPDQDPGQLFPMVLLVFLLLGGAWYLQLQ-----------
Q61337_BAD-09          KFHLGSRHTHHPVSLTAQCRASWWWGPDSGCQNE-----AHSFLLLP---
Q9JM54_PMAIP1-03       --------TRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT---
Q9JM54_PMAIP1-02       --------TR--ADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT---
                                                                         

O54918_BCL2L11-01      WRRH-------
O54918_BCL2L11-03      -----------
O54918_BCL2L11-05      WRRH-------
O54918_BCL2L11-08      WRRH-------
O54918_BCL2L11-06      WRRH-------
Q91ZE9_BMF-02          QENREGVGPW-
P62816_HRK-03          -----------
Q99ML1_BBC3-01         -----------
Q99ML1_BBC3-03         -----------
B2RVL4_BBC3-01         DPGAPEMEPN-
Q99ML1_BBC3-02         DPGAPEMEPN-
Q91ZE9_BMF-06          -----------
Q91ZE9_BMF-01          -----------
Q61337_BAD-07          PVPSPGLCLHL
Q61337_BAD-05          -----------
Q61337_BAD-02          -----------
Q61337_BAD-01          NLGKGGSTPSQ
Q61337_BAD-04          NLGKGGSTPSQ
Q61337_BAD-06          NLGKGGSTPSQ
Q61337_BAD-03          NLGKGGSTPSQ
Q9JM54_PMAIP1-01       -----------
O70337_BIK-04          -----------
O70337_BIK-03          -----------
O70337_BIK-01          -----------
O70337_BIK-02          -----------
Q61337_BAD-09          -----------
Q9JM54_PMAIP1-03       -----------
Q9JM54_PMAIP1-02       -----------
                                  

© 1998-2022Legal notice