Dataset for protein classical BH3-containing proteins of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

28 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


P62816_HRK-03          --------------------------------------------------
Q99ML1_BBC3-01         --------------------------------------------------
Q99ML1_BBC3-03         --------------------------------------------------
Q91ZE9_BMF-01          MPGAGVFWKQYRAVCRGLLPRQLAPAAVAAAARATASHRSPLEFAPFFPI
Q91ZE9_BMF-06          --------------------------------------------------
Q9JM54_PMAIP1-01       --------------------------------------------------
O70337_BIK-04          --------------------------------------------------
O70337_BIK-03          --------------------------------------------------
O70337_BIK-01          --------------------------------------------------
O70337_BIK-02          --------------------------------------------------
O54918_BCL2L11-01      --------------------------------------------------
O54918_BCL2L11-03      --------------------------------------------------
O54918_BCL2L11-05      --------------------------------------------------
O54918_BCL2L11-06      --------------------------------------------------
O54918_BCL2L11-08      --------------------------------------------------
Q91ZE9_BMF-02          --------------------------------------------------
B2RVL4_BBC3-01         --------------------------------------------------
Q99ML1_BBC3-02         --------------------------------------------------
Q61337_BAD-07          --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-02          -------------------------------------------MGTPKQP
Q61337_BAD-01          -------------------------------------------MGTPKQP
Q61337_BAD-09          --------------------------------------------------
Q9JM54_PMAIP1-02       --------------------------------------------------
Q9JM54_PMAIP1-03       --------------------------------------------------
                                                                         

P62816_HRK-03          --------------------------------------------------
Q99ML1_BBC3-01         ------------------------------------------------MA
Q99ML1_BBC3-03         ------------------------------------------------MA
Q91ZE9_BMF-01          ECGHQAPRVFFTLDPGAEPWHHNSEAETLSWSHPGEMEPPQCVEELEDDV
Q91ZE9_BMF-06          ------------------------------------MEPPQCVEELEDDV
Q9JM54_PMAIP1-01       -----------------------------------------------MPG
O70337_BIK-04          --------------------------------------------------
O70337_BIK-03          -------------------------------------MSEARLMARDVIK
O70337_BIK-01          -------------------------------------MSEARLMARDVIK
O70337_BIK-02          -------------------------------------MSEARLMARDVIK
O54918_BCL2L11-01      ---------------------------------------MAKQPSDVSSE
O54918_BCL2L11-03      ---------------------------------------MAKQPSDVSSE
O54918_BCL2L11-05      ---------------------------------------MAKQPSDVSSE
O54918_BCL2L11-06      ---------------------------------------MAKQPSDVSSE
O54918_BCL2L11-08      ---------------------------------------MAKQPSDVSSE
Q91ZE9_BMF-02          -------------------------------MSPGEMEPPQCVEELEDDV
B2RVL4_BBC3-01         ------------------------------------------------MA
Q99ML1_BBC3-02         ------------------------------------------------MA
Q61337_BAD-07          ------------------------------------XQIPEFEPSEQEDA
Q61337_BAD-05          -----------------------------------MFQIPEFEPSEQEDA
Q61337_BAD-06          -----------------------------------MFQIPEFEPSEQEDA
Q61337_BAD-03          -----------------------------------MFQIPEFEPSEQEDA
Q61337_BAD-04          -----------------------------------MFQIPEFEPSEQEDA
Q61337_BAD-02          SLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDA
Q61337_BAD-01          SLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDA
Q61337_BAD-09          --------------------------------------------------
Q9JM54_PMAIP1-02       --------------------------------------------------
Q9JM54_PMAIP1-03       --------------------------------------------------
                                                                         

P62816_HRK-03          -----------------MCPCPRHRGRGPPAVCGCGDARPG---------
Q99ML1_BBC3-01         RARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPG---------
Q99ML1_BBC3-03         RARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPG---------
Q91ZE9_BMF-01          FQSEDGEPGT-----------------QPGGLLSADLFAQS---------
Q91ZE9_BMF-06          FQSEDGEPGT-----------------QPGGLLSADLFAQS---------
Q9JM54_PMAIP1-01       RKARRNAPVNPTRAELPP------------------EFAAQ---------
O70337_BIK-04          -------------------------------MFTRNQVALR---------
O70337_BIK-03          TVPHDQVPQPPVASETPSMKEPVRDVDLMECVEGRNQVALR---------
O70337_BIK-01          TVPHDQVPQPPVASETPSMKEPVRDVDLMECVEGRNQVALR---------
O70337_BIK-02          TVPHDQVPQPPVASETPSMKEPVRDVDLMECVEGRNQVALR---------
O54918_BCL2L11-01      CDREGG-------QLQPAERPPQ----LRPGAPTSLQTEPQGNPDGEGDR
O54918_BCL2L11-03      CDREGG-------QLQPAERPPQ----LRPGAPTSLQTEPQ---------
O54918_BCL2L11-05      CDREGG-------QLQPAERPPQ----LRPGAPTSLQTEPQ---------
O54918_BCL2L11-06      CDREGG-------QLQPAERPPQ----LRPGAPTSLQTEPQ---------
O54918_BCL2L11-08      CDREGG-------QLQPAERPPQ----LRPGAPTSLQTEPQ---------
Q91ZE9_BMF-02          FQSEDGEPG--------TQPG---------GLLSADLFAQS---------
B2RVL4_BBC3-01         RARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPG---------
Q99ML1_BBC3-02         RARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPG---------
Q61337_BAD-07          SATDRGLGP----SLTEDQPGPY----LAPGLLGSNIHQQG---------
Q61337_BAD-05          SATDRGLGP----SLTEDQPGPY----LAPGLLGSNIHQQG---------
Q61337_BAD-06          SATDRGLGP----SLTEDQPGPY----LAPGLLGSNIHQQG---------
Q61337_BAD-03          SATDRGLGP----SLTEDQPGPY----LAPGLLGSNIHQQG---------
Q61337_BAD-04          SATDRGLGP----SLTEDQPGPY----LAPGLLGSNIHQQG---------
Q61337_BAD-02          SATDRGLGP----SLTEDQPGPY----LAPGLLGSNIHQQG---------
Q61337_BAD-01          SATDRGLGP----SLTEDQPGPY----LAPGLLGSNIHQQG---------
Q61337_BAD-09          --------------------------------------------------
Q9JM54_PMAIP1-02       --------------------------------------------------
Q9JM54_PMAIP1-03       --------------------------------------------------
                                                                         

P62816_HRK-03          ---------------------LRWAAAQVTALRLQALGDELHRRAMRRRA
Q99ML1_BBC3-01         ---------------------LPAAPAA----------------------
Q99ML1_BBC3-03         ---------------------LPAAPAA----------------------
Q91ZE9_BMF-01          ---------------------QLDCPLS----------------------
Q91ZE9_BMF-06          ---------------------QLDCPLS----------------------
Q9JM54_PMAIP1-01       --------------------------------------------------
O70337_BIK-04          --------------------------------------------------
O70337_BIK-03          --------------------------------------------------
O70337_BIK-01          --------------------------------------------------
O70337_BIK-02          --------------------------------------------------
O54918_BCL2L11-01      CPHGSPQGPLAPPASPGPFATRSPLFIF----------------------
O54918_BCL2L11-03      --------------------------------------------------
O54918_BCL2L11-05      --------------------------------------------------
O54918_BCL2L11-06      --------------------------------------------------
O54918_BCL2L11-08      --------------------------------------------------
Q91ZE9_BMF-02          ---------------------QLDCPLS----------------------
B2RVL4_BBC3-01         ---------------------LPAAPAA----------------------
Q99ML1_BBC3-02         ---------------------LPAAPAA----------------------
Q61337_BAD-07          ---------------------RAATNSH----------------------
Q61337_BAD-05          ---------------------RAATNSH----------------------
Q61337_BAD-06          ---------------------RAATNSH----------------------
Q61337_BAD-03          ---------------------RAATNSH----------------------
Q61337_BAD-04          ---------------------RAATNSH----------------------
Q61337_BAD-02          ---------------------RAATNSH----------------------
Q61337_BAD-01          ---------------------RAATNSH----------------------
Q61337_BAD-09          --------------------------------------------------
Q9JM54_PMAIP1-02       --------------------------------------------------
Q9JM54_PMAIP1-03       --------------------------------------------------
                                                                         

P62816_HRK-03          RPRDPLPALLPALRARWPWLCAAAQVAALAA------WLLG----RRSA-
Q99ML1_BBC3-01         ------PALLPA-----AYLCAPTAPPAVTAALGGPRWPGG----HRSRP
Q99ML1_BBC3-03         ------PALLPA-----AYLCAPTAPPAVTAALGGPRWPGG----HRSRP
Q91ZE9_BMF-01          ------RLQLFP-----LTHCCGPGLRPISQEDKATQTLSP----ASPSQ
Q91ZE9_BMF-06          ------RLQLFP-----LTHCCGPGLRPISQEDKATQTLSP----ASPSQ
Q9JM54_PMAIP1-01       -------------------------LRKIGDKVYCTWSAPDITVVLAQMP
O70337_BIK-04          -------------------------LACIGDEMDLCLRSPR----LVQLP
O70337_BIK-03          -------------------------LACIGDEMDLCLRSPR----LVQLP
O70337_BIK-01          -------------------------LACIGDEMDLCLRSPR----LVQLP
O70337_BIK-02          -------------------------LACIGDEMDLCLRSPR----LVQLP
O54918_BCL2L11-01      ------VRRSSL-----LSRSSSGYFSFDTDRSPAPMSCDK----STQTP
O54918_BCL2L11-03      ------------------------------DRSPAPMSCDK----STQTP
O54918_BCL2L11-05      ------------------------------DRSPAPMSCDK----STQTP
O54918_BCL2L11-06      --------------------------------------------------
O54918_BCL2L11-08      --------------------------------------------------
Q91ZE9_BMF-02          ------RLQLFP-----LTHCCGPGLRPISQEDKATQTLSP----ASPSQ
B2RVL4_BBC3-01         ------PALLPA-----AYLCAPTAPPAVTAALGGPRWPGG----HRSRP
Q99ML1_BBC3-02         ------PALLPA-----AYLCAPTAPPAVTAALGGPRWPGG----HRSRP
Q61337_BAD-07          -----------------------------HGGAGAMETRSR----HSSYP
Q61337_BAD-05          -----------------------------HGGAGAMETRSR----HSSYP
Q61337_BAD-06          -----------------------------HGGAGAMETRSR----HSSYP
Q61337_BAD-03          -----------------------------HGGAGAMETRSR----HSSYP
Q61337_BAD-04          -----------------------------HGGAGAMETRSR----HSSYP
Q61337_BAD-02          -----------------------------HGGAGAMETRSR----HSSYP
Q61337_BAD-01          -----------------------------HGGAGAMETRSR----HSSYP
Q61337_BAD-09          --------------------------------------------------
Q9JM54_PMAIP1-02       --------------------------------------------------
Q9JM54_PMAIP1-03       --------------------------------------------------
                                                                         

P62816_HRK-03          --------------------------------------------------
Q99ML1_BBC3-01         RGPRPD--------------------------------------------
Q99ML1_BBC3-03         RGPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPTQAAPGVRV-------
Q91ZE9_BMF-01          GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRA
Q91ZE9_BMF-06          GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRA
Q9JM54_PMAIP1-01       GKSQKSRMRSPSPTRVPADLKDECAQL-----------------------
O70337_BIK-04          GIAIHRLAVTYSRTGVRGIFRSLIRSL-----------------------
O70337_BIK-03          GIAIHRLAVTYSRTGVRGIFRSLIRSL-----------------------
O70337_BIK-01          GIAIHRLAVTYSRTGVRGIFRSLIRSL-----------------------
O70337_BIK-02          GIAIHRLAVTYSRTGVRGIFRSLIRSL-----------------------
O54918_BCL2L11-01      SPPCQAFNHYLSAMASIRQSQEEPEDL---------------------RP
O54918_BCL2L11-03      SPPCQAFNHYLSAMDQLENLNQVAQNI---------------------H-
O54918_BCL2L11-05      SPPCQAFNHYLSAMASIRQSQEEPEDL---------------------RP
O54918_BCL2L11-06      --------------ASIRQSQEEPEDL---------------------RP
O54918_BCL2L11-08      --------------ASIRQSQEEPEDL---------------------RP
Q91ZE9_BMF-02          GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQPPEGQFLQHRA
B2RVL4_BBC3-01         RGPRPD-GPQPSLSPAQQHLESPVPSAPEALAGGPTQAAPGVRVEEEEW-
Q99ML1_BBC3-02         RGPRPD-GPQPSLSPAQQHLESPVPSAPEALAGGPTQAAPGVRVEEEEW-
Q61337_BAD-07          AGTEEDEGMEEELSPFRGRSRSAPPNL---------------------WA
Q61337_BAD-05          AGTEEDEGMEEELSPFRGRSRSAPPNL---------------------WA
Q61337_BAD-06          AGTEEDEGMEEELSPFRGRSRSAPPNL---------------------WA
Q61337_BAD-03          AGTEEDEGMEEELSPFRGRSRSAPPNL---------------------WA
Q61337_BAD-04          AGTEEDEGMEEELSPFRGRSRSAPPNL---------------------WA
Q61337_BAD-02          AGTEEDEGMEEELSPFRGRSRSAPPNL---------------------WA
Q61337_BAD-01          AGTEEDEGMEEELSPFRGRSRSAPPNL---------------------WA
Q61337_BAD-09          ------------------------------------------------XA
Q9JM54_PMAIP1-02       ------------------------------------------------MP
Q9JM54_PMAIP1-03       ------------------------------------------------MP
                                                                         

P62816_HRK-03          --------------------------------------------------
Q99ML1_BBC3-01         --------------------------------------------------
Q99ML1_BBC3-03         --------------------------------------------------
Q91ZE9_BMF-01          EVQIARKLQCIADQFHRLHTQQ--------------------------HQ
Q91ZE9_BMF-06          EVQIARKLQCIADQFHRLHTQQ--------------------------HQ
Q9JM54_PMAIP1-01       --------RRIGDKV---------------------------------NL
O70337_BIK-04          --------TNLRENIWSWRVLTPGAWVSP------------------DQD
O70337_BIK-03          --------TNLRENIWSWRVLTPGAWVSP------------------DQD
O70337_BIK-01          --------TNLRENIWSWRVLTPGAWVSP------------------DQD
O70337_BIK-02          --------TNLRENIWSWRVLTPGAWVSP------------------DQD
O54918_BCL2L11-01      EIRIAQELRRIGDEFNETYTRRVFANDYR------------------EAE
O54918_BCL2L11-03      -----------GDAWYN---------------------------------
O54918_BCL2L11-05      EIRIAQELRRIGDEFNETYTRRVFANDYR------------------EAE
O54918_BCL2L11-06      EIRIAQELRRIGDEFNETYTRRVFANDYR------------------EAE
O54918_BCL2L11-08      EIRIAQELRRIGDEFNETYTRRVFANDYR------------------EAE
Q91ZE9_BMF-02          EVQIARKLQCIADQFHRLHTQQ---HQQN------------------RDR
B2RVL4_BBC3-01         AREIGAQLRRMADDLNAQYERR---RQEE------------------QHR
Q99ML1_BBC3-02         AREIGAQLRRMADDLNAQYERR---RQEE------------------QHR
Q61337_BAD-07          AQRYGRELRRMSDEFEGSFKSM---LGLA------------------VLI
Q61337_BAD-05          AQRYGRELRRMSDEFEGSFKVS---ASVR------------------CDG
Q61337_BAD-06          AQRYGRELRRMSDEFEGSFKGL---PRPK------------------SAG
Q61337_BAD-03          AQRYGRELRRMSDEFEGSFKGL---PRPK------------------SAG
Q61337_BAD-04          AQRYGRELRRMSDEFEGSFKGL---PRPK------------------SAG
Q61337_BAD-02          AQRYGRELRRMSDEFEGSFKG-----------------------------
Q61337_BAD-01          AQRYGRELRRMSDEFEGSFKGL---PRPK------------------SAG
Q61337_BAD-09          AQRYGRELRRMSDEFEGSFKFHLGSRHTHHPVSLTAQCRASWWWGPDSGC
Q9JM54_PMAIP1-02       GRKAR-RNAPVNP--------------TR--ADLKDECAQLRRIGDKVNL
Q9JM54_PMAIP1-03       GKSQKSRMRSPSP--------------TRVPADLKDECAQLRRIGDKVNL
                                                                         

P62816_HRK-03          --------------------------------
Q99ML1_BBC3-01         --------------------------------
Q99ML1_BBC3-03         --------------------------------
Q91ZE9_BMF-01          QNRDRAWWQVFLFLQNLALNRQENREGVGPW-
Q91ZE9_BMF-06          QNRDRAWWQVFLFLQNLALNRQENREGVGPW-
Q9JM54_PMAIP1-01       RQKLLNLISKLFNLVT----------------
O70337_BIK-04          PGQLFPMVLLVFLLLGGAWYLQLQ--------
O70337_BIK-03          PGQLFPMVLLVFLLLGG---------------
O70337_BIK-01          PGQLFPMVLLVFLLLGGAWYLQLQ--------
O70337_BIK-02          PGQLFPMVLLVFLLLGGAWYLQLQ--------
O54918_BCL2L11-01      DHPQMVILQLLRFIFRLVWRRH----------
O54918_BCL2L11-03      --------------------------------
O54918_BCL2L11-05      DHPQMVILQLLRFIFRLVWRRH----------
O54918_BCL2L11-06      DHPQMVILQLLRFIFRLVWRRH----------
O54918_BCL2L11-08      DHPQMVILQLLRFIFRLVWRRH----------
Q91ZE9_BMF-02          AWWQV-----FLFLQNLALNRQENREGVGPW-
B2RVL4_BBC3-01         HRPSPWRVMYNLFMGLLPLPRDPGAPEMEPN-
Q99ML1_BBC3-02         HRPSPWRVMYNLFMGLLPLPRDPGAPEMEPN-
Q61337_BAD-07          RPLSVSSDLLGFPPSSSFVQDPVPSPGLCLHL
Q61337_BAD-05          T-------------------------------
Q61337_BAD-06          TATQMRQSAGWTRIIQSWWDRNLGKGGSTPSQ
Q61337_BAD-03          TATQMRQSAGWTRIIQSWWDRNLGKGGSTPSQ
Q61337_BAD-04          TATQMRQSAGWTRIIQSWWDRNLGKGGSTPSQ
Q61337_BAD-02          --EELTYSLSPFRCVQ----------------
Q61337_BAD-01          TATQMRQSAGWTRIIQSWWDRNLGKGGSTPSQ
Q61337_BAD-09          QNE-----AHSFLLLP----------------
Q9JM54_PMAIP1-02       RQKLLNLISKLFNLVT----------------
Q9JM54_PMAIP1-03       RQKLLNLISKLFNLVT----------------
                                                       

© 1998-2022Legal notice