Dataset for protein classical BH3-containing proteins of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

28 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q91ZE9_BMF-01          MPGAGVFWKQYRAVCRGLLPRQLAPAAVAAAARATASHRSPLEFAPFFPI
Q91ZE9_BMF-06          --------------------------------------------------
Q9JM54_PMAIP1-01       --------------------------------------------------
O70337_BIK-04          --------------------------------------------------
O70337_BIK-03          --------------------------------------------------
O70337_BIK-02          --------------------------------------------------
O70337_BIK-01          --------------------------------------------------
Q91ZE9_BMF-02          --------------------------------------------------
B2RVL4_BBC3-01         --------------------------------------------------
Q99ML1_BBC3-02         --------------------------------------------------
Q61337_BAD-07          --------------------------------------------------
Q61337_BAD-05          --------------------------------------------------
Q61337_BAD-04          --------------------------------------------------
Q61337_BAD-06          --------------------------------------------------
Q61337_BAD-03          --------------------------------------------------
Q61337_BAD-02          -------------------------------------------MGTPKQP
Q61337_BAD-01          -------------------------------------------MGTPKQP
O54918_BCL2L11-03      --------------------------------------------------
O54918_BCL2L11-01      --------------------------------------------------
O54918_BCL2L11-08      --------------------------------------------------
O54918_BCL2L11-06      --------------------------------------------------
O54918_BCL2L11-05      --------------------------------------------------
P62816_HRK-03          --------------------------------------------------
Q99ML1_BBC3-01         --------------------------------------------------
Q99ML1_BBC3-03         --------------------------------------------------
Q61337_BAD-09          --------------------------------------------------
Q9JM54_PMAIP1-03       --------------------------------------------------
Q9JM54_PMAIP1-02       --------------------------------------------------
                                                                         

Q91ZE9_BMF-01          ECGHQAPRVFFTLDPGAEPWHHNSEAETLSWSHPGEMEPPQCVEELEDDV
Q91ZE9_BMF-06          ------------------------------------MEPPQCVEELEDDV
Q9JM54_PMAIP1-01       --------------------------------------------------
O70337_BIK-04          --------------------------------------------------
O70337_BIK-03          --------------------------------------------------
O70337_BIK-02          --------------------------------------------------
O70337_BIK-01          --------------------------------------------------
Q91ZE9_BMF-02          -------------------------------MSPGEMEPPQCVEELEDDV
B2RVL4_BBC3-01         ------------------------------------------------MA
Q99ML1_BBC3-02         ------------------------------------------------MA
Q61337_BAD-07          ------------------------------------XQIPEFEPSEQEDA
Q61337_BAD-05          -----------------------------------MFQIPEFEPSEQEDA
Q61337_BAD-04          -----------------------------------MFQIPEFEPSEQEDA
Q61337_BAD-06          -----------------------------------MFQIPEFEPSEQEDA
Q61337_BAD-03          -----------------------------------MFQIPEFEPSEQEDA
Q61337_BAD-02          SLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDA
Q61337_BAD-01          SLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDA
O54918_BCL2L11-03      -----------------------------------------------MAK
O54918_BCL2L11-01      -----------------------------------------------MAK
O54918_BCL2L11-08      -----------------------------------------------MAK
O54918_BCL2L11-06      -----------------------------------------------MAK
O54918_BCL2L11-05      -----------------------------------------------MAK
P62816_HRK-03          --------------------------------------------------
Q99ML1_BBC3-01         ------------------------------------------------MA
Q99ML1_BBC3-03         ------------------------------------------------MA
Q61337_BAD-09          --------------------------------------------------
Q9JM54_PMAIP1-03       --------------------------------------------------
Q9JM54_PMAIP1-02       --------------------------------------------------
                                                                         

Q91ZE9_BMF-01          FQSEDGEPG--------TQPG---------GLLSADLF------------
Q91ZE9_BMF-06          FQSEDGEPG--------TQPG---------GLLSADLF------------
Q9JM54_PMAIP1-01       --------------------------------------------------
O70337_BIK-04          --------------------------------------------------
O70337_BIK-03          --------------------------------------------------
O70337_BIK-02          --------------------------------------------------
O70337_BIK-01          --------------------------------------------------
Q91ZE9_BMF-02          FQSEDGEPG--------TQPG---------GLLSADLF------------
B2RVL4_BBC3-01         RARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLC------------
Q99ML1_BBC3-02         RARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLC------------
Q61337_BAD-07          SATDRGLGP----SLTEDQPGPY----LAPGLLGSNIH------------
Q61337_BAD-05          SATDRGLGP----SLTEDQPGPY----LAPGLLGSNIH------------
Q61337_BAD-04          SATDRGLGP----SLTEDQPGPY----LAPGLLGSNIH------------
Q61337_BAD-06          SATDRGLGP----SLTEDQPGPY----LAPGLLGSNIH------------
Q61337_BAD-03          SATDRGLGP----SLTEDQPGPY----LAPGLLGSNIH------------
Q61337_BAD-02          SATDRGLGP----SLTEDQPGPY----LAPGLLGSNIH------------
Q61337_BAD-01          SATDRGLGP----SLTEDQPGPY----LAPGLLGSNIH------------
O54918_BCL2L11-03      QPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQ------------
O54918_BCL2L11-01      QPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGEGDRCPH
O54918_BCL2L11-08      QPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQ------------
O54918_BCL2L11-06      QPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQ------------
O54918_BCL2L11-05      QPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQ------------
P62816_HRK-03          -----------------MCPCPRHRGRGPPAVCGCGDA------------
Q99ML1_BBC3-01         RARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLC------------
Q99ML1_BBC3-03         RARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLC------------
Q61337_BAD-09          --------------------------------------------------
Q9JM54_PMAIP1-03       --------------------------------------------------
Q9JM54_PMAIP1-02       --------------------------------------------------
                                                                         

Q91ZE9_BMF-01          ---------------AQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKAT
Q91ZE9_BMF-06          ---------------AQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKAT
Q9JM54_PMAIP1-01       --------------------------------------------------
O70337_BIK-04          --------------------------------------------------
O70337_BIK-03          --------------------------------------------MSEARL
O70337_BIK-02          --------------------------------------------MSEARL
O70337_BIK-01          --------------------------------------------MSEARL
Q91ZE9_BMF-02          ---------------AQSQLDCPLSRLQLFPLTHCCGPGLRPISQEDKAT
B2RVL4_BBC3-01         ---------------EPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGP
Q99ML1_BBC3-02         ---------------EPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGGP
Q61337_BAD-07          ---------------QQGRAATNSH------------------HGGAGAM
Q61337_BAD-05          ---------------QQGRAATNSH------------------HGGAGAM
Q61337_BAD-04          ---------------QQGRAATNSH------------------HGGAGAM
Q61337_BAD-06          ---------------QQGRAATNSH------------------HGGAGAM
Q61337_BAD-03          ---------------QQGRAATNSH------------------HGGAGAM
Q61337_BAD-02          ---------------QQGRAATNSH------------------HGGAGAM
Q61337_BAD-01          ---------------QQGRAATNSH------------------HGGAGAM
O54918_BCL2L11-03      --------------------------------------------DRSPAP
O54918_BCL2L11-01      GSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAP
O54918_BCL2L11-08      --------------------------------------------------
O54918_BCL2L11-06      --------------------------------------------------
O54918_BCL2L11-05      --------------------------------------------DRSPAP
P62816_HRK-03          ----------------------------------------------RPGL
Q99ML1_BBC3-01         ----------------------------------------------EPGL
Q99ML1_BBC3-03         ----------------------------------------------EPGL
Q61337_BAD-09          --------------------------------------------------
Q9JM54_PMAIP1-03       --------------------------------------------------
Q9JM54_PMAIP1-02       --------------------------------------------------
                                                                         

Q91ZE9_BMF-01          QTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQP
Q91ZE9_BMF-06          QTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQP
Q9JM54_PMAIP1-01       ----MPGRKARRNAPVNPTRAELPP-------------------------
O70337_BIK-04          --------------------------------------M-----------
O70337_BIK-03          MARDVIKTVPHDQVPQPPVASETPSMKEPVRDVDLMECV-----------
O70337_BIK-02          MARDVIKTVPHDQVPQPPVASETPSMKEPVRDVDLMECV-----------
O70337_BIK-01          MARDVIKTVPHDQVPQPPVASETPSMKEPVRDVDLMECV-----------
Q91ZE9_BMF-02          QTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGSPLGEQP
B2RVL4_BBC3-01         RWPGGHRSRPRGPRPD-GPQPSLSPAQQHLESPVPSAPEALAGGPTQAAP
Q99ML1_BBC3-02         RWPGGHRSRPRGPRPD-GPQPSLSPAQQHLESPVPSAPEALAGGPTQAAP
Q61337_BAD-07          ETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPNL-------------
Q61337_BAD-05          ETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPNL-------------
Q61337_BAD-04          ETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPNL-------------
Q61337_BAD-06          ETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPNL-------------
Q61337_BAD-03          ETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPNL-------------
Q61337_BAD-02          ETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPNL-------------
Q61337_BAD-01          ETRSRHSSYPAGTEEDEGMEEELSPFRGRSRSAPPNL-------------
O54918_BCL2L11-03      MSCDKSTQTPSPPCQAFNHYLSAMDQLENLNQVAQNI-------------
O54918_BCL2L11-01      MSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDL-------------
O54918_BCL2L11-08      ------------------------ASIRQSQEEPEDL-------------
O54918_BCL2L11-06      ------------------------ASIRQSQEEPEDL-------------
O54918_BCL2L11-05      MSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDL-------------
P62816_HRK-03          RWAAAQVTALRLQALGDELHRRAMRRRARPRDPLPAL-------------
Q99ML1_BBC3-01         PAAPAA----------------------------PAL-------------
Q99ML1_BBC3-03         PAAPAA----------------------------PAL-------------
Q61337_BAD-09          --------------------------------------------------
Q9JM54_PMAIP1-03       --------------------------------------------------
Q9JM54_PMAIP1-02       --------------------------------------------------
                                                                         

Q91ZE9_BMF-01          PEGQFLQHRAEVQIARKLQCIADQFHRLHTQQH-----------------
Q91ZE9_BMF-06          PEGQFLQHRAEVQIARKLQCIADQFHRLHTQQH-----------------
Q9JM54_PMAIP1-01       ------------EFAAQLRKIGDKVYCTWSAPDITVVLAQMPGKSQKSRM
O70337_BIK-04          --------FTRNQVALRLACIGDEMDLCLRSPR----LVQLPGIAIHRLA
O70337_BIK-03          --------EGRNQVALRLACIGDEMDLCLRSPR----LVQLPGIAIHRLA
O70337_BIK-02          --------EGRNQVALRLACIGDEMDLCLRSPR----LVQLPGIAIHRLA
O70337_BIK-01          --------EGRNQVALRLACIGDEMDLCLRSPR----LVQLPGIAIHRLA
Q91ZE9_BMF-02          PEGQFLQHRAEVQIARKLQCIADQFHRLHTQQH-----------------
B2RVL4_BBC3-01         GVRVEEEEW-AREIGAQLRRMADDLNAQYERRR-----------------
Q99ML1_BBC3-02         GVRVEEEEW-AREIGAQLRRMADDLNAQYERRR-----------------
Q61337_BAD-07          --------WAAQRYGRELRRMSDEFEGSFKSML-----------------
Q61337_BAD-05          --------WAAQRYGRELRRMSDEFEGSFKVSA-----------------
Q61337_BAD-04          --------WAAQRYGRELRRMSDEFEGSFKGLP-----------------
Q61337_BAD-06          --------WAAQRYGRELRRMSDEFEGSFKGLP-----------------
Q61337_BAD-03          --------WAAQRYGRELRRMSDEFEGSFKGLP-----------------
Q61337_BAD-02          --------WAAQRYGRELRRMSDEFEGSFKG-------------------
Q61337_BAD-01          --------WAAQRYGRELRRMSDEFEGSFKGLP-----------------
O54918_BCL2L11-03      --------H------------GDAWYN-----------------------
O54918_BCL2L11-01      --------RPEIRIAQELRRIGDEFNETYTRRV---------FANDYREA
O54918_BCL2L11-08      --------RPEIRIAQELRRIGDEFNETYTRRV---------FANDYREA
O54918_BCL2L11-06      --------RPEIRIAQELRRIGDEFNETYTRRV---------FANDYREA
O54918_BCL2L11-05      --------RPEIRIAQELRRIGDEFNETYTRRV---------FANDYREA
P62816_HRK-03          --------LPALRA-----------------------------RWPWLCA
Q99ML1_BBC3-01         --------LPA----------------------------------AYLCA
Q99ML1_BBC3-03         --------LPA----------------------------------AYLCA
Q61337_BAD-09          --------XAAQRYGRELRRMSDEFEGSFKFHL--------------GSR
Q9JM54_PMAIP1-03       --------MPGKSQKSRMRSPSP---------------------------
Q9JM54_PMAIP1-02       --------MPGRKAR-RNAPVNP---------------------------
                                                                         

Q91ZE9_BMF-01          ----QQNRDRAWWQV-----FLFLQNLALNRQENREGVGPW---------
Q91ZE9_BMF-06          ----QQNRDRAWWQV-----FLFLQNLALNRQENREGVGPW---------
Q9JM54_PMAIP1-01       RSPSPTRVPADLKDECAQLRRIGDKV---------------NLRQKLLNL
O70337_BIK-04          VTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAWVSPDQDPGQLFPM
O70337_BIK-03          VTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAWVSPDQDPGQLFPM
O70337_BIK-02          VTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAWVSPDQDPGQLFPM
O70337_BIK-01          VTYSRTGVRGIFRSLIRSLTNLRENIWSWRVLTPGAWVSPDQDPGQLFPM
Q91ZE9_BMF-02          ----QQNRDRAWWQV-----FLFLQNLALNRQENREGVGPW---------
B2RVL4_BBC3-01         ----QEEQHRHRPSPWRVMYNLFMGLLPLPRDPGAPEMEPN---------
Q99ML1_BBC3-02         ----QEEQHRHRPSPWRVMYNLFMGLLPLPRDPGAPEMEPN---------
Q61337_BAD-07          ----GLAVLIRPLSVSSDLLGFPPSSSFVQDPVPSPGLCLHL--------
Q61337_BAD-05          ----SVRCDGT---------------------------------------
Q61337_BAD-04          ----RPKSAGTATQMRQSAGWTRIIQSWWDRNLGKGGSTPSQ--------
Q61337_BAD-06          ----RPKSAGTATQMRQSAGWTRIIQSWWDRNLGKGGSTPSQ--------
Q61337_BAD-03          ----RPKSAGTATQMRQSAGWTRIIQSWWDRNLGKGGSTPSQ--------
Q61337_BAD-02          ------------EELTYSLSPFRCVQ------------------------
Q61337_BAD-01          ----RPKSAGTATQMRQSAGWTRIIQSWWDRNLGKGGSTPSQ--------
O54918_BCL2L11-03      --------------------------------------------------
O54918_BCL2L11-01      EDHPQMVILQLLRFIFRLVWRRH---------------------------
O54918_BCL2L11-08      EDHPQMVILQLLRFIFRLVWRRH---------------------------
O54918_BCL2L11-06      EDHPQMVILQLLRFIFRLVWRRH---------------------------
O54918_BCL2L11-05      EDHPQMVILQLLRFIFRLVWRRH---------------------------
P62816_HRK-03          AAQVAALAA------WLLGRRSA---------------------------
Q99ML1_BBC3-01         PTAPPAVTAALGGPRWPGGHRSRPRGPRPD--------------------
Q99ML1_BBC3-03         PTAPPAVTAALGGPRWPGGHRSRPRGPRPDGPQPSLSPAQQHLESPVPSA
Q61337_BAD-09          HTHHPVSLTAQCRASWWWGPDSGCQNE-----AHSFLLLP----------
Q9JM54_PMAIP1-03       -TRVPADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT----------
Q9JM54_PMAIP1-02       -TR--ADLKDECAQLRRIGDKVNLRQKLLNLISKLFNLVT----------
                                                                         

Q91ZE9_BMF-01          -----------------
Q91ZE9_BMF-06          -----------------
Q9JM54_PMAIP1-01       ISKLFNLVT--------
O70337_BIK-04          VLLVFLLLGGAWYLQLQ
O70337_BIK-03          VLLVFLLLGG-------
O70337_BIK-02          VLLVFLLLGGAWYLQLQ
O70337_BIK-01          VLLVFLLLGGAWYLQLQ
Q91ZE9_BMF-02          -----------------
B2RVL4_BBC3-01         -----------------
Q99ML1_BBC3-02         -----------------
Q61337_BAD-07          -----------------
Q61337_BAD-05          -----------------
Q61337_BAD-04          -----------------
Q61337_BAD-06          -----------------
Q61337_BAD-03          -----------------
Q61337_BAD-02          -----------------
Q61337_BAD-01          -----------------
O54918_BCL2L11-03      -----------------
O54918_BCL2L11-01      -----------------
O54918_BCL2L11-08      -----------------
O54918_BCL2L11-06      -----------------
O54918_BCL2L11-05      -----------------
P62816_HRK-03          -----------------
Q99ML1_BBC3-01         -----------------
Q99ML1_BBC3-03         PEALAGGPTQAAPGVRV
Q61337_BAD-09          -----------------
Q9JM54_PMAIP1-03       -----------------
Q9JM54_PMAIP1-02       -----------------
                                        

© 1998-2021Legal notice