Dataset for protein Bim of organism Mus musculus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************************************                                       
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQ---------------------------------------
                                         gnpdgegdrcphgspqgplappaspgpfatrsplfifvr

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                 ****************************** .: : :: .:::.            ** : : 
-----------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMdslrqsqqvpqnlr------------GDewyn-
rssllsrsssgyfsfdt                              aqienlneeaedihpeiriaqelrri  afnet

       170       180       190      
....:....|....:....|....:....|....:.
                                    
------------------------------------
ytrrvfandyreaedhpqmvilqllrfifrlvwrrh
© 1998-2020Legal notice