Dataset for protein Bim of organism Mus musculus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


O54918_BCL2L11-03      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQ---------
O54918_BCL2L11-01      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGEGDR
                       *****************************************         

O54918_BCL2L11-03      -----------------------------------------------DRS
O54918_BCL2L11-01      CPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
                                                                      ***

O54918_BCL2L11-03      PAPMSCDKSTQTPSPPCQAFNHYLSAMDQLENLNQVAQNIH---------
O54918_BCL2L11-01      PAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQEL
                       *************************** .: : :: .:::.         

O54918_BCL2L11-03      ---GDAWYN-------------------------------------
O54918_BCL2L11-01      RRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH
                          ** : :                                     

© 1998-2020Legal notice