Dataset for protein Puma of organism Moschus moschiferus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                         .   ** *.*. ** *::           :* .*.    
mararqegsspepveglardgprpfplsrlvpsavscglceagae  p a al  a ffcapttppavtaa ga hwpgg

        90       100       110       120       130       140       150       160
        .  *********************************************************************

       170       180       190   
© 1998-2022Legal notice