Dataset for protein Puma of organism Moschus moschiferus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C6CSS1_BBC3-02      MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAA
A0A8C6CSS1_BBC3-01      ---------------------------------------VRATAEAARAC
                                                                 .   ** *.

A0A8C6CSS1_BBC3-02      PALLPAAYLCAPTTPPAVTAALGAPRWPGGPRSRPRGPRPDGPQPSLSPA
A0A8C6CSS1_BBC3-01      PCQLPRAFF-----------SLWVPH------------QIRGPQPSLSPA
                        *. ** *::           :* .*.            .  *********

A0A8C6CSS1_BBC3-02      EQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNA
A0A8C6CSS1_BBC3-01      EQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNA
                        **************************************************

A0A8C6CSS1_BBC3-02      LYERRRQEEQQRHRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN
A0A8C6CSS1_BBC3-01      LYERRRQEEQQRHRPSPWRVLYNLIMGLLPFPGGRGAPEVEPN
                        *******************************************

© 1998-2022Legal notice