Dataset for protein Noxa of organism Microcebus murinus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*******************     .            :**. :. .* *    * :  . : **                
MPVKKARKNAQPSPTRTRAgtgrtcv-----------mQLrrlgpsLlFqqplLplpvklitSGt---------------
                   eieeeaetaregarcgvgl  qfiadk h ppkc nfigddfr  rrmcsstqenrrqtaf

        90       100       110       
....:....|....:....|....:....|....:..
                                     
-------------------------------------
paettefdsqtfplrnltdfsqsrykfhqledrshcn
© 1998-2022Legal notice