Dataset for protein Noxa of organism Microcebus murinus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8B7HMR3_PMAIP1-      MPVKKARKNAQPSPTRTRAGTGRTAETAREGARCGVGMQLQFLAPSLLFP
A0A8B7HMR3_PMAIP1-      MPVKKARKNAQPSPTRTRAEIEEECV-----------LQLRRIGDKLHFQ
                        *******************     .            :**. :. .* * 

A0A8B7HMR3_PMAIP1-      PPCLPFPGDDITSGRRMCSSTQENRRQTAFPAETTEFDSQTFPLRNLTDF
A0A8B7HMR3_PMAIP1-      QKLLNLIVKLFRSGT-----------------------------------
                           * :  . : **                                    

A0A8B7HMR3_PMAIP1-      SQSRYKFHQLEDRSHCN
A0A8B7HMR3_PMAIP1-      -----------------
                                         

© 1998-2022Legal notice