Dataset for protein Bmf of organism Microcebus murinus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MEPSQCVEELEDDVFQPEDGESGTQPGSVLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************. *  .  : *. *        *:: .::.* *                              
GVMLPCGVTEEPQRLFYgnAgyrlplpAsfPaglplgeqPaegqwqhRaEvqiarklqciadqfhrlhvqqhqqnqnrvw
                 ap epksrvv dp l------- tqprfer r ------------------------------

       170       180    
....:....|....:....|....
                 .: .**.
wqillflhnlalngeenrngaGPr
-----------------qerg  q
© 1998-2022Legal notice