Dataset for protein Bmf of organism Microcebus murinus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5UXV9_BMF-01      MEPSQCVEELEDDVFQPEDGESGTQPGSVLSADLFAQSQLDCPLSRLQLF
A0A8C5UXV9_BMF-02      MEPSQCVEELEDDVFQPEDGESGTQPGSVLSADLFAQSQLDCPLSRLQLF
A0A8C5UXV9_BMF-03      MEPSQCVEELEDDVFQPEDGESGTQPGSVLSADLFAQSQLDCPLSRLQLF
                       **************************************************

A0A8C5UXV9_BMF-01      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA
A0A8C5UXV9_BMF-02      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNA
A0A8C5UXV9_BMF-03      PLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPA
                       ***********************************************. *

A0A8C5UXV9_BMF-01      GYRLPLPASFPAGLPLGEQPAEGQWQHRAEVQIARKLQCIADQFHRLHVQ
A0A8C5UXV9_BMF-02      GYRLPLPASFPAGLPLGEQPAEGQWQHRAEVQIARKLQCIADQFHRLHVQ
A0A8C5UXV9_BMF-03      EPKSRVVADPPL-------PTQPRFERRRE--------------------
                         .  : *. *        *:: .::.* *                    

A0A8C5UXV9_BMF-01      QHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR
A0A8C5UXV9_BMF-02      QHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR
A0A8C5UXV9_BMF-03      ---------------------------QERGGPQ
                                                  .: .**.

© 1998-2022Legal notice