Dataset for protein Bmf of organism Mastacembelus armatus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MDDEEDDVFEPDPHFWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDQEVRQ
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*********************************************         : *   ::. *.:*:    :*:*  *
QEREEEQNRMEQLPRQQPLVHSVEACIGQKLQLIGDQFHREHLQL--------qvlWwrlttgsLsvLldr-tlItGvwR
                                             yhlnqrnqglg apeasal pl faclgf a gg 

    
....
 *  
eG--
a rr
© 1998-2020Legal notice