Dataset for protein Bmf of organism Mastacembelus armatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3RVI2_BMF-02      MDDEEDDVFEPDPHFWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAE
A0A3Q3RVI2_BMF-01      MDDEEDDVFEPDPHFWRTTFREIKCEDRGTQTPGPALALNNGMLPCGVAE
                       **************************************************

A0A3Q3RVI2_BMF-02      EPRPLFYGNAGFRLHFPAHFELVGDQEVRQQEREEEQNRMEQLPRQQPLV
A0A3Q3RVI2_BMF-01      EPRPLFYGNAGFRLHFPAHFELVGDQEVRQQEREEEQNRMEQLPRQQPLV
                       **************************************************

A0A3Q3RVI2_BMF-02      HSVEACIGQKLQLIGDQFHREHLQLYHLNQRNQGLLWWRLATALLSLLFD
A0A3Q3RVI2_BMF-01      HSVEACIGQKLQLIGDQFHREHLQL--------QVGWAPETSGSLPVLLA
                       *************************         : *   ::. *.:*: 

A0A3Q3RVI2_BMF-02      R-GFIAGGGRAGRR
A0A3Q3RVI2_BMF-01      CLTLITGVWREG--
                          :*:*  * *  

© 1998-2020Legal notice