Dataset for protein Bim of organism Malurus cyaneus samueli

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mgrgaggragpgalgrsprsaprrqpdgqaapevkarrdgeggrlpaaegrararscarrprrlpgpgrpgvaaaaargp

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                      .*.. ::..:: .   .**.: .*             **  *****************
--------------------tyrSssgyysvqsvrsvlpLGsnkpT-------------LShmASRWQSHSPAEEVQPEI
ptgpfatrsplfifvrrspllpk nceffgfeaeqfpaa  cdaa qtpsppcqalshc  aa                 

       170       180       190       200       210       220    
....:....|....:....|....:....|....:....|....:....|....:....|....
******  :        *   ::** .: :    :*                            
WIAQELssl-------yCpvrvtFLsslvisplgqG----------------------------
      rrigdefnasl lrfls  fcfsfllkfk fldfqvgnpqvvilrllryiirliwrlq
© 1998-2022Legal notice