Dataset for protein Bim of organism Malurus cyaneus samueli

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5TVU9_BCL2L11      --------------------------------------------------
A0A8C5UI47_BCL2L11      MGRGAGGRAGPGALGRSPRSAPRRQPDGQAAPEVKARRDGEGGRLPAAEG
                                                                          

A0A8C5TVU9_BCL2L11      --------------------------------------------------
A0A8C5UI47_BCL2L11      RARARSCARRPRRLPGPGRPGVAAAAARGPPTGPFATRSPLFIFVRRSPL
                                                                          

A0A8C5TVU9_BCL2L11      TYKSNCEFYGVQSVQFVLALGSNAPT-------------LSHAASRWQSH
A0A8C5UI47_BCL2L11      LPRSSSGYFSFEAERSPAPLGCDKATQTPSPPCQALSHCLSAMASRWQSH
                          .*.. ::..:: .   .**.: .*             **  *******

A0A8C5TVU9_BCL2L11      SPAEEVQPEIWIAQELRRIGDEFNASYCPRRVTFLSSLSISLKGKG----
A0A8C5UI47_BCL2L11      SPAEEVQPEIWIAQELSSL-------LCLVFLSFLFCFVFLPLFQGFLDF
                        ****************  :        *   ::** .: :    :*    

A0A8C5TVU9_BCL2L11      ------------------------
A0A8C5UI47_BCL2L11      QVGNPQVVILRLLRYIIRLIWRLQ
                                                

© 1998-2022Legal notice