Dataset for protein Bim of organism Malurus cyaneus samueli

[Download (right click)] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A8C5UI47_BCL2L11-01      MGRGAGGRAGPGALGRSPRSAPRRQPDGQAAPEVKARRDGEGGRLPAAEG
A0A8C5TVU9_BCL2L11-01      --------------------------------------------------
                                                                             

A0A8C5UI47_BCL2L11-01      RARARSCARRPRRLPGPGRPGVAAAAARGPPTGPFATRSPLFIFVRRSPL
A0A8C5TVU9_BCL2L11-01      --------------------------------------------------
                                                                             

A0A8C5UI47_BCL2L11-01      LPRSSSGYFSFEAERSPAPLGCDKATQTPSPPCQALSHCLSAMASRWQSH
A0A8C5TVU9_BCL2L11-01      TYKSNCEFYGVQSVQFVLALGSNAPT-------------LSHAASRWQSH
                             :*.. ::..:: :   .**.: .*             **  *******

A0A8C5UI47_BCL2L11-01      SPAEEVQPEIWIAQELSSLL-------CLVFLSFLFCFVFLPLFQGFLDF
A0A8C5TVU9_BCL2L11-01      SPAEEVQPEIWIAQELRRIGDEFNASYCPRRVTFLSSLS-----------
                           ****************  :        *   ::** .:            

A0A8C5UI47_BCL2L11-01      QVGNPQVVILRLLRYIIRLIWRLQ
A0A8C5TVU9_BCL2L11-01      ----------------IS-LKGKG
                                           *  :    

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice