Dataset for protein classical BH3-containing proteins of organism Macaca nemestrina

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                       *                                                        
--------epsrcveeledrvlqPspgepgaqpgsslsaqlfaqslldsplsrlqlfplthccgpg-rptsqed------
mfqmpkqm----messraedqfg edtraqpsdsgpchtda--lg---c-qqe---s-sh------l-------pfatrs
 sgiaefpsdvsspgks-rknav aerpdrlr--aktgr-tpr--wgagh---qpt-s--vsssgwysspgete      
   vrpiepseqedcdkyg-gqe rtag---glp--hals-epflndv-nrlkeldlmpplggtatvlasessg      
       srktl----- -q-mc lassrtw- evv---arrgavfrstmpghytrpkklgppr pad rwprq      
        i fgvgtl  cpl   c mh  rv cqta p pgq  dplnlhegdgngiekff q l a lahp       
               a    c     l    e a i  c  d    ki f  a  h ead   a     g ci       
                                   e           e d       c                      
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------katqtlgpa-----spsqsvmlpcgvteepq-----------------------r-ap
plfifmrrssllsrsssgyfsfdsdrsaarmkywgdeldagtr--ap---s--rlfygnagyrlplpasfpavlpi-qre
                      --q--r--leqstr-i-kqlqts--pcqaqnqhaenvklrtsgvvhylsqmasrgeq-
                      av-vvpsk-cclaqqcw----vmslasl-fy    ap mps r tfiydl qtwlr-q
                      qtpnp-levaai  l-hvraprlvetqngev       ekk   awdp   erl pvn
                      h emls  e      mgr  km rdsld ds        ha          dd  lel
                         ld          ae    a   de   g                        d a
                         ga                         a                           
                         a                                                      

       170       180       190       200       210       220       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
                                                                   
pegqwphrrevqiarrlgrianqfhalr---------------------------------------
rsrmrqepa-l---lk-qc-pdp--rrhvqqhqqnrnrvwwqillflhnlalngeenrngagprrcm
-afta-ai-i-vel--w--s---yy---awlppysnresvplvvilrllrymalsvgglhqllk   
q-d--t--tgrryywgirdeflargwvapsrnwtrgqhqhl m     a livrlsw mtpi f   
lvasprttwvapttmpywlltahqalesmpmlnrqalgd             pa qe g l      
at-rkgslgr lrrkiml kcf vshcklhcegn  a                              
 qehd r  l enn ff  c    fea  f   d                                 
 p e  f  a  ki     a         e                                     
 c    c     gh                                                     
© 1998-2020Legal notice