Dataset for protein classical BH3-containing proteins of organism Macaca nemestrina

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------makqpsdvsse------cdre-----------------------------------grqlqpaerppql
ikfgvgsarac--qv-rrsvetwvpcqi----erhgprtpggqlpgarrgpgprrpaplparppgal-------dsesge
           pfmerefcpa-rg pavqelr                                   ddvfmlekgsraa
            c-i -ae--g      lgps                                   psratag-ka-kn
            sg- p--rr        mtq                                   agl r rs-ll--
              c cplhd        ac                                     aa l lrt-eyp
                 i                                                     g  qhrasc
                                                                           a    
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
rpga---------------------------------Ptslqtepqgnpegnhggegdscphgspqgplappaspg----
qglsslsadlfaqslldcplsrlqlfplthccgpglrlspaedkatqt-g-ar--q--ml-----ee---l-y--agtgs
aqpgprp arclplrphr tr hrhpggpplawgspq laqggrls--l-p--ps-sv--dcsvt--qqr-f-hn- p  
---r                                  krrpap--dsgkthsqapellwrathqllgptsssghs    
vls-                                  gtma-gvrsraphvartaapganrrgapptywawltr     
tare                                  a    -ghvhtmwrllrr rwvgvpqr  rrqgrelf     
  a                                        d e ehlaq dqf qvsafndk  nmm mdfc     
                                             a aca p  e  fri ei    d i k da     
                                                   l      q   a      g h c      
                                                          k          d d a      
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------pf---sp-----------------------drspapmscdks
prgggtvgpgdrgpaaadggrpqrairaaetrgaaatpg-atr--lfifmrrssllsrsssgyfsfdt------------
                                      -yvwygsveergdsdayaaglarsrveaslsartrvvdvrse
                                      qtlvsrapwvlehtpnptvqvqcpgnqyqaglcwsrtaelgq
                                      krkselqsqtssghnmesqkt  i dlmevqmpvpqsptvdr
                                      eqerad alsip ghldql p     gl e eimlapkqpad
                                      ap l     lhh  ee p  m     ce    eee l leq 
                                       l a     c                       a  g f   
                                       k                                        
                                       a                                        
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
tqtpsppcqafnhylsamasrr-------r-e------l-----------------------------------------
-------l-----a--plgt--qaepadm-p-iriaqe-rrigdefnayyarrvqlnnyqaaeqhpqmvilrllrylvrl
ggrarlw-ptsfp-vl-ireqppegqwqhltlvqptrkeqclayqrsrlpvqqhfkpwdrtsgdnsvrlwwqi lfihnp
vssslsqpdllrsqgdk---mlgtfvpsfearptlrvrvttyrwrwhpshtslnsswrspnl rgrnl v l   a lla
srmhpqntwfyarlmvfkvrlseswadrvtwpgf ktlrnltqmwqksnwrgwmradpp     eqs           m 
rpl e grvewynitrsgcviivlvrvlskrnca hsgggimhhnh qftqavlk  f                    a 
phh d   l iqleqgr tpwgrhrmrgpagf   fgf ehk fh  cd f afh                         
aae a   f a d nel pnveldqk e   a     a da  cg   a e  ce                         
        a      ae klpdd ig a                         a                          
                d  if                                                           
                   de                                                           
                   c                                                            
                   a                                                            

       330    
....:....|....
              
--------------
vwrghenrngagpr
alnmgltqlpkrcm
lss e hlilf   
sqv           
              
              
              
              
              
              
              
              
© 1998-2022Legal notice