Dataset for protein classical BH3-containing proteins of organism Macaca nemestrina

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------makqpsdvsse------c-------------dregrqlqpa---erppqlrpga---------------
ikfgvgsarac--qv-rrsvetwvpcqi-gprerhgprtpgg---------eprrdgesgaqglsslsadlfaqslldcp
           pfmerefcpa-rg pavq             elsddvfml-lalkssraeaqpga gsv rplrarpgc
            c-i -ae--g      l             qtrparrgag   skalknvlst               
            sg- p--rr                     mpqaslat r   qtlvysthar               
              c cplhd                     gcp ga l p   ph espha e               
                 i                        a             a ap                    
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------Ptslqtepqgnp--------------------------------------------------
lsrlqlfplthccgpglrlsraedkatqt-lawgspqpaprptpgrssalalaggaapgvaraqrpggpggrshpggpgs
rp rprpaarclplrph  -pqgarls--l                                                  
                   lart-g--dsg                                                  
                   ktmhr- hvpa                                                  
                   g  aqh gsrt                                                  
                       gd e er                                                  
                          a ac                                                  
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------egnhggeg-scphgspqeplappaspgpfatrsplfifmrrss----------------spapmscdks
prgggtvgpgd--ar----d--------g-------------------------llsrsssgyfsfdtdr----------
           gp--paqsvmldcsvte-qqrlfyhnagyrlplqasfpavspiyaaglqcprneaqaslrtsvvdvrsq
           khhsqspellwrathqlptptsssghpqtvwygaveerggldlvtqkta igdqmevgacvrrlaelge
           rwvqrqa rraqvpgaalrywgwlat erksgvvswytedtnapsl p     ll l mpspasvtpdr
           ptraler qwpgriir aetmamelf aqgrerspqtsshkkndp  m     ge e  eml ppqerg
           n p d d gv  ead   drd ddda  peiam  hslr hem                 ee g l q 
           m   a                 a c   l a d  dpil                     a    f   
                                       a       lhh                              
                                               c                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
tqtpsppcqafnhylsam--r-----a-----------l---g--------------l----------------------
-----------------las-rqaep-dmrpeiriaqe-rri-dewwfnayyarrlf-nnyqarndhpqmvllvllllla
ggreqqwegqwqsrgev-iamkrqliveqfhrlhvqphqqnrnrvlgqirsflpnvakrgeenaegarpss         
vrgallvpdtlaraadkqvtwqltcvrtfvdsfttlttptvlvtsktwrllpfhtswvyscwptqsgggrn         
shsqv nlwsyylqmvficwpitrvspswsenvsqtlr ksftnttrywqklswqrvfsrwtlstlterlh         
remhp grvlrvdistqepviekkrll tm gpkgp q egargksqmgggsqtlmscqppshpgfpqhq          
hah e  arfirc nrl grfdghmgd  e ade   l  d eaimncf finngilapfhrgh  e e           
a e a   fea    ge  ne ee a   a   a   a      h l    c kfge ladhe                 
        a       d  l   d                    a          ad k   d                 
                   i                                                            

       330        
....:....|....:...
                  
------------------
llilrllryivrlvwrmh
  lplssggltqipk cm
  mawqv   hl lf   
  hnsf            
  ckd             
  a a             
                  
                  
                  
© 1998-2022Legal notice