Dataset for protein classical BH3-containing proteins of organism Macaca nemestrina

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6BV43_PMAIP1-      ------------MPGKKARKNAQPSPTRAQAELEVECATQLRRFGDKLNF
A0A2K6AYL7_HRK-01       ---------------------MCPCPLHRGRGPPAVCACSAGRLGLRSS-
A0A2K6B5F6_BMF-03       -------MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCP
A0A2K6B5F6_BMF-01       -------MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCP
A0A2K6B5F6_BMF-02       -------MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCP
A0A2K6B5F6_BMF-04       -------MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCP
A0A2K6E212_BCL2L11      ---MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ------
A0A2K6E212_BCL2L11      ---MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGN
A0A2K6DBJ4_BIK-01       MSGVRPISRDTLMETLLYEQLLEPLTME----------------VLGVTD
A0A2K6E7I4_BAD-03       MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASH
A0A2K6E7I4_BAD-02       MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASH
A0A2K6ASP2_BBC3-03      --------IKFGVGSARACPCQVPRASSATWVPCQICGPQP-------SL
A0A2K6BV43_PMAIP1-      ------------MPGKKARKNAQPSPTRAQAGPAGTAGTARDQAGFGIGM
                                               *                          

A0A2K6BV43_PMAIP1-      RQKLLNLIAKLFCSGT----------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
A0A2K6B5F6_BMF-03       LSRLQLFPLTHCCGPGLRPTSQED--------------------------
A0A2K6B5F6_BMF-01       LSRLQLFPLTHCCGPGLRPTSQED--------------------------
A0A2K6B5F6_BMF-02       LSRLQLFPLTHCCGPGLRPTSQED--------------------------
A0A2K6B5F6_BMF-04       LSRLQLFPLTHCCGPGLRPTSQED--------------------------
A0A2K6E212_BCL2L11      --------------------------------------------------
A0A2K6E212_BCL2L11      HGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYF
A0A2K6DBJ4_BIK-01       PEEDLDPMEDF------DPLECIE--------------------------
A0A2K6E7I4_BAD-03       QQEQPTSSSHHGGRAWYSPSWESE--------------------------
A0A2K6E7I4_BAD-02       QQEQPTSSSHHGGT---SSPEERG--------------------------
A0A2K6ASP2_BBC3-03      LLAEQHLESPVPSAPGALAGGPTQ--------------------------
A0A2K6BV43_PMAIP1-      QLHYTRGKKLVSSSPLVLPRGHEE--------------------------
                                                                          

A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K6AYL7_HRK-01       --AAQLTAARLKALGDELHQRTM---------------------------
A0A2K6B5F6_BMF-03       --KATQTLGPA-----SPSQGVMLPCGVTEEPQRLFYAPAEPKSRVVADP
A0A2K6B5F6_BMF-01       --KATQTLGPA-----SPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASF
A0A2K6B5F6_BMF-02       --KATQTLGPA-----SPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASF
A0A2K6B5F6_BMF-04       --KATQTLGPA-----SPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASF
A0A2K6E212_BCL2L11      ----DRSPAPM-----SCDKSTQTPSPPCQAFN--------------HYL
A0A2K6E212_BCL2L11      SFDTDRSPAPM-----SCDKSTQTPSPPCQAFN--------------HYL
A0A2K6DBJ4_BIK-01       --DSDMLALRLACIGDEMDVSLRAPRLAQLSEV------AMHSLGLAFIY
A0A2K6E7I4_BAD-03       --DSENPSARM-----LAEASARMSAPATDSEAQHAENVKLKALGL-W--
A0A2K6E7I4_BAD-02       --HSDADAAKL-----QLDASLPVLVGSELGQG------KLRTLPVTF--
A0A2K6ASP2_BBC3-03      --AAPGVRGEEEQWAREIGAQLRRMADDLNAQY-----------------
A0A2K6BV43_PMAIP1-      --QVQVARSRVCYSTQEIWRQTKLPAETSESDS-----------------
                                                                          

A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K6AYL7_HRK-01       -----WRRRARSRRAPAPGALPTYWPWLCAAAQVAALAAWLLGRRNL---
A0A2K6B5F6_BMF-03       PL-----PAQPCFEWRR---------------------------------
A0A2K6B5F6_BMF-01       PAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
A0A2K6B5F6_BMF-02       PAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
A0A2K6B5F6_BMF-04       PAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
A0A2K6E212_BCL2L11      SAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEDH
A0A2K6E212_BCL2L11      SAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRMSLPPD------
A0A2K6DBJ4_BIK-01       DQMDDIRDVLRSFMDGFTTLRENIMRFWRSPNPRSWVS--------REQV
A0A2K6E7I4_BAD-03       --------RPAVATAPTPRGRRRTKGWRRSPAPFGAARAPRPPTSGQHSV
A0A2K6E7I4_BAD-02       --------APRPETPPALTVLVGHLGYGRKCFPQALCK--------RGSV
A0A2K6ASP2_BBC3-03      ---ERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN------
A0A2K6BV43_PMAIP1-      ---QTLLLRNLTASKTCIRGLQKRLFLRRCTLHQFEERLHCNW-------
                                                                          

A0A2K6BV43_PMAIP1-      ---------------------------
A0A2K6AYL7_HRK-01       ---------------------------
A0A2K6B5F6_BMF-03       --------------EQERGGP------
A0A2K6B5F6_BMF-01       WQILLFLHNLALNGEENRNGAGPR---
A0A2K6B5F6_BMF-02       WQILLFLHNLALNGEENRNGAGPR---
A0A2K6B5F6_BMF-04       WQILLFLHNLALNGEENRNGAGPR---
A0A2K6E212_BCL2L11      PQMVILRLLRYIVRLVWRMH-------
A0A2K6E212_BCL2L11      ---------------------------
A0A2K6DBJ4_BIK-01       LLVLLLLLALLLALLSGGLHLLLK---
A0A2K6E7I4_BAD-03       -----------MAASSGG---------
A0A2K6E7I4_BAD-02       -----------LPLSVGGLTQIPFRCM
A0A2K6ASP2_BBC3-03      ---------------------------
A0A2K6BV43_PMAIP1-      ---------------------------
                                                   

© 1998-2020Legal notice