Dataset for protein classical BH3-containing proteins of organism Macaca nemestrina

[Download (right click)] [Edit] [Sequences] [Repertoires]

24 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K6ASP2_BBC3-01      IKFGVGSARACPCQVPRASSATWVPCQICGPRERHGPRTPGGQLPGARRG
A0A2K6AYL7_HRK-01       -------------MCPCPLHRGRGPPAVCACS------------------
A0A2K6ASP2_BBC3-02      IKFGVGSARACPCQVPRASSATWVPCQICETR------------------
A0A2K6B5F6_BMF-01       -------------MEPSRCVEE--------LE------------------
A0A2K6B5F6_BMF-02       -------------MEPSRCVEE--------LE------------------
A0A2K6B5F6_BMF-04       -------------MEPSRCVEE--------LE------------------
A0A2K6B5F6_BMF-03       -------------MEPSRCVEE--------LE------------------
A0A2K6ASP2_BBC3-03      IKFGVGSARACPCQVPRASSATWVPCQICGPQ------------------
A0A2K6DBJ4_BIK-01       -----------MSGVRPISRDT------LM--------------------
A0A2K6E7I4_BAD-01       -----------MFQIPEFEPSE------QE--------------------
A0A2K6E7I4_BAD-02       -----------MFQIPEFEPSE------QE--------------------
A0A2K6E7I4_BAD-03       -----------MFQIPEFEPSE------QE--------------------
A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      -----------MAKQPSDVSSE------CDRE------------------
A0A2K6E1Z6_BCL2L11      -----------MAKQPSDVSSE------CDRE------------------
A0A2K6E1Z6_BCL2L11      -----------MAKQPSDVSSE------CDRE------------------
A0A2K6E1Z6_BCL2L11      -----------MAKQPSDVSSE------CDRE------------------
A0A2K6E1Z6_BCL2L11      -----------MAKQPSDVSSE------CDRE------------------
A0A2K6E1Z6_BCL2L11      -----------MAKQPSDVSSE------CDRE------------------
A0A2K6E1Z6_BCL2L11      -----------MAKQPSDVSSE------CDRE------------------
A0A2K6E1Z6_BCL2L11      -----------MAKQPSDVSSE------CDRE------------------
A0A2K6E1Z6_BCL2L11      -----------MAKQPSDVSSE------CDRE------------------
A0A2K6E1Z6_BCL2L11      -----------MAKQPSDVSSE------CDRE------------------
                                                                          

A0A2K6BV43_PMAIP1-      ---------------------MPGKKARKNAQPS----------------
A0A2K6ASP2_BBC3-01      PGPRRPAPLPARPPGALGSVLRPLRARPGCRPRRPRPAARCLPLRPHRPT
A0A2K6AYL7_HRK-01       -----------------AGRLGLRSSAAQLTAAR----------------
A0A2K6ASP2_BBC3-02      -----------------GAAATP---------------------------
A0A2K6B5F6_BMF-01       -----------------DDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPL
A0A2K6B5F6_BMF-02       -----------------DDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPL
A0A2K6B5F6_BMF-04       -----------------DDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPL
A0A2K6B5F6_BMF-03       -----------------DDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPL
A0A2K6ASP2_BBC3-03      -----------------PSLLLAEQHLESPVPSA----------------
A0A2K6DBJ4_BIK-01       ------------------------ETLLYEQLLE----------------
A0A2K6E7I4_BAD-01       ------------------------DSSSAERGLG----------------
A0A2K6E7I4_BAD-02       ------------------------DSSSAERGLG----------------
A0A2K6E7I4_BAD-03       ------------------------DSSSAERGLG----------------
A0A2K6BV43_PMAIP1-      ---------------------MPGKKARKNAQPS----------------
A0A2K6E1Z6_BCL2L11      -----------------GRQLQPAERPPQLRPGA----------------
A0A2K6E1Z6_BCL2L11      -----------------GRQLQPAERPPQLRPGA----------------
A0A2K6E1Z6_BCL2L11      -----------------GRQLQPAERPPQLRPGA----------------
A0A2K6E1Z6_BCL2L11      -----------------GRQLQPAERPPQLRPGA----------------
A0A2K6E1Z6_BCL2L11      -----------------GRQLQPAERPPQLRPGA----------------
A0A2K6E1Z6_BCL2L11      -----------------GRQLQPAERPPQLRPGA----------------
A0A2K6E1Z6_BCL2L11      -----------------GRQLQPAERPPQLRPGA----------------
A0A2K6E1Z6_BCL2L11      -----------------GRQLQPAERPPQLRPGA----------------
A0A2K6E1Z6_BCL2L11      -----------------GRQLQPAERPPQLRPGA----------------
A0A2K6E1Z6_BCL2L11      -----------------GRQLQPAERPPQLRPGA----------------
                                                                          

A0A2K6BV43_PMAIP1-      -----------------PTRAQAELEVECATQLRRFGDKLNFRQKLLNLI
A0A2K6ASP2_BBC3-01      RRHRHPGGPPLAWGSPQPAPRPTPGRSSALALAGGAAPGVARAQRPGGPG
A0A2K6AYL7_HRK-01       -----------------LKALGDELHQRTMWRRRARSRRAPAPGALPTYW
A0A2K6ASP2_BBC3-02      -----------------PLALEGPVQSHHGTPALTQGPQSPRNGAQ----
A0A2K6B5F6_BMF-01       SRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQR
A0A2K6B5F6_BMF-02       SRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQR
A0A2K6B5F6_BMF-04       SRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQR
A0A2K6B5F6_BMF-03       SRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQR
A0A2K6ASP2_BBC3-03      -----------------PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRM
A0A2K6DBJ4_BIK-01       -----------------PLTME----------------VLGVTDPEEDLD
A0A2K6E7I4_BAD-01       -----------------PSPAGDRPSDSGKHHRQAPGLLWDASHQQEQPT
A0A2K6E7I4_BAD-02       -----------------PSPAGDRPSDSGKHHRQAPGLLWDASHQQEQPT
A0A2K6E7I4_BAD-03       -----------------PSPAGDRPSDSGKHHRQAPGLLWDASHQQEQPT
A0A2K6BV43_PMAIP1-      -----------------PTRAQAGPAGTAGTARDQAGFGI-------GMQ
A0A2K6E1Z6_BCL2L11      -----------------PTSLQTDP-------------------------
A0A2K6E1Z6_BCL2L11      -----------------PTSLQTEPQ------------------------
A0A2K6E1Z6_BCL2L11      -----------------PTSLQTEPQ------------------------
A0A2K6E1Z6_BCL2L11      -----------------PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA
A0A2K6E1Z6_BCL2L11      -----------------PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA
A0A2K6E1Z6_BCL2L11      -----------------PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA
A0A2K6E1Z6_BCL2L11      -----------------PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA
A0A2K6E1Z6_BCL2L11      -----------------PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA
A0A2K6E1Z6_BCL2L11      -----------------PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA
A0A2K6E1Z6_BCL2L11      -----------------PTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA
                                                                          

A0A2K6BV43_PMAIP1-      AKLFCSGT------------------------------------------
A0A2K6ASP2_BBC3-01      GRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQRAIRAAETRGAAATPPL
A0A2K6AYL7_HRK-01       PWLCAA------------------------------------------AQ
A0A2K6ASP2_BBC3-02      --------------------------------------------------
A0A2K6B5F6_BMF-01       LFYGNA------------------------------------------GY
A0A2K6B5F6_BMF-02       LFYGNA------------------------------------------GY
A0A2K6B5F6_BMF-04       LFYGNA------------------------------------------GY
A0A2K6B5F6_BMF-03       LFYAPA------------------------------------------EP
A0A2K6ASP2_BBC3-03      ADDLNA------------------------------------------QY
A0A2K6DBJ4_BIK-01       PMEDF---------------------------------------------
A0A2K6E7I4_BAD-01       SSSHHG------------------------------------------GA
A0A2K6E7I4_BAD-02       SSSHHG------------------------------------------GT
A0A2K6E7I4_BAD-03       SSSHHG------------------------------------------GR
A0A2K6BV43_PMAIP1-      LHYTRG------------------------------------------KK
A0A2K6E1Z6_BCL2L11      -----G------------------------------------------PF
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      PPASPG------------------------------------------PF
A0A2K6E1Z6_BCL2L11      PPASPG------------------------------------------PF
A0A2K6E1Z6_BCL2L11      PPASPG------------------------------------------PF
A0A2K6E1Z6_BCL2L11      PPASPG------------------------------------------PF
A0A2K6E1Z6_BCL2L11      PPASPG------------------------------------------PF
A0A2K6E1Z6_BCL2L11      PPASPG------------------------------------------PF
A0A2K6E1Z6_BCL2L11      PPASPG------------------------------------------PF
                                                                          

A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K6ASP2_BBC3-01      ALEGPVQSHHGTPALTQGPQSPRNGAQLGACTRPVDVRDSGGRPLPPPDT
A0A2K6AYL7_HRK-01       VAALAAWLLGRRNL------------------------------------
A0A2K6ASP2_BBC3-02      ---------------------------LGACTRPVDVRDSGGRPLPPPDT
A0A2K6B5F6_BMF-01       --------------------------------------------RLPLPA
A0A2K6B5F6_BMF-02       --------------------------------------------RLPLPA
A0A2K6B5F6_BMF-04       --------------------------------------------RLPLPA
A0A2K6B5F6_BMF-03       KSR---------------------------------VVADPPLPAQPCFE
A0A2K6ASP2_BBC3-03      ERRRQ-------------------------------EEQQRHRPSPWRVL
A0A2K6DBJ4_BIK-01       ---DPLECIEDSDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAF
A0A2K6E7I4_BAD-01       ---GAVETRSRHSSYPAGT-----EEDEGMEEEPSPFRGRSRSAPPNLWA
A0A2K6E7I4_BAD-02       ---SSPEERGHSDADAAKL-----QLDASLPVLVGSELGQG---------
A0A2K6E7I4_BAD-03       AWYSPSWESEDSENPSARM-----LAEASARMSAPATDSEAQHAE-----
A0A2K6BV43_PMAIP1-      LVSSSPLVLPRGHEEQVQVARSRVCYSTQEIWRQTKLPAETSESDSQTLL
A0A2K6E1Z6_BCL2L11      ATRSP-------------------------------CDKSTQTPSPPCQA
A0A2K6E1Z6_BCL2L11      ----------------------------DRSPAPMSCDKSTQTPSPPCQA
A0A2K6E1Z6_BCL2L11      ----------------------------DRSPAPMSCDKSTQTPSPPCQA
A0A2K6E1Z6_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
A0A2K6E1Z6_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
A0A2K6E1Z6_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
A0A2K6E1Z6_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
A0A2K6E1Z6_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
A0A2K6E1Z6_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
A0A2K6E1Z6_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
                                                                          

A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K6ASP2_BBC3-01      LASAGDFLCTM---------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
A0A2K6ASP2_BBC3-02      LASAGDFLCTM---------------------------------------
A0A2K6B5F6_BMF-01       SFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQ-----
A0A2K6B5F6_BMF-02       SFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQ-----
A0A2K6B5F6_BMF-04       SFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQ-----
A0A2K6B5F6_BMF-03       WRREQERGGP----------------------------------------
A0A2K6ASP2_BBC3-03      YNLIMGLLPLPRGHRAPEMEPN----------------------------
A0A2K6DBJ4_BIK-01       IYDQMDDIRDVLRSFMDGFTTL-----RENIMRFWRSPNPRSWVS-----
A0A2K6E7I4_BAD-01       AQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDR
A0A2K6E7I4_BAD-02       ------KLRTLPVTFAPRPETPPALTVLVGHLGYGRKCFPQALCK-----
A0A2K6E7I4_BAD-03       ----NVKLKALGL-WRPAVATAPTPRGRRRTKGWRRSPAPFGAARAPRPP
A0A2K6BV43_PMAIP1-      LRNLTASKTCIRGLQKRLFLRRCTLHQFEERLHCNW--------------
A0A2K6E1Z6_BCL2L11      FNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQ
A0A2K6E1Z6_BCL2L11      FNHYLSAMVVILEDIGDSSLWFGFIFTGLDLYGHHHSQDTEQLNHKDFS-
A0A2K6E1Z6_BCL2L11      FNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQ
A0A2K6E1Z6_BCL2L11      FNHYLSAMANWD--------------------------------------
A0A2K6E1Z6_BCL2L11      FNHYLSAMGIFE--------------------------------------
A0A2K6E1Z6_BCL2L11      FNHYLSAMVREIEEVVV---------------------------------
A0A2K6E1Z6_BCL2L11      FNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQ
A0A2K6E1Z6_BCL2L11      FNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQ
A0A2K6E1Z6_BCL2L11      FNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRLEK----
A0A2K6E1Z6_BCL2L11      FNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRMSLPPD-
                                                                          

A0A2K6BV43_PMAIP1-      ----------------------------------
A0A2K6ASP2_BBC3-01      ----------------------------------
A0A2K6AYL7_HRK-01       ----------------------------------
A0A2K6ASP2_BBC3-02      ----------------------------------
A0A2K6B5F6_BMF-01       ---QNRNRVWWQILLFLHNLALNGEENRNGAGPR
A0A2K6B5F6_BMF-02       ---QNRNRVWWQILLFLHNLALNGEENRNGAGPR
A0A2K6B5F6_BMF-04       ---QNRNRVWWQILLFLHNLALNGEENRNGAGPR
A0A2K6B5F6_BMF-03       ----------------------------------
A0A2K6ASP2_BBC3-03      ----------------------------------
A0A2K6DBJ4_BIK-01       ---REQVLLVLLLLLALLLALLSGGLHLLLK---
A0A2K6E7I4_BAD-01       NLGRGSS-----------APSQ------------
A0A2K6E7I4_BAD-02       ---RGSV-----------LPLSVGGLTQIPFRCM
A0A2K6E7I4_BAD-03       TSGQHSV-----------MAASSGG---------
A0A2K6BV43_PMAIP1-      ----------------------------------
A0A2K6E1Z6_BCL2L11      AAEDHPQMVILRLLRYIVRLVWRMH---------
A0A2K6E1Z6_BCL2L11      ----------------------------------
A0A2K6E1Z6_BCL2L11      AAEDHPQMVILRLLRYIVRLVWRMH---------
A0A2K6E1Z6_BCL2L11      ----------------------------------
A0A2K6E1Z6_BCL2L11      ----------------------------------
A0A2K6E1Z6_BCL2L11      ----------------------------------
A0A2K6E1Z6_BCL2L11      AAEDHPQMVILRLLRYIVRLVWRMH---------
A0A2K6E1Z6_BCL2L11      AAEDHPQMVILRLLRYIVRLVWRMH---------
A0A2K6E1Z6_BCL2L11      ----------------------------------
A0A2K6E1Z6_BCL2L11      ----------------------------------
                                                          

© 1998-2022Legal notice