Dataset for protein classical BH3-containing proteins of organism Macaca nemestrina

[Download (right click)] [Edit] [Sequences] [Repertoires]

24 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6BV43_PMAIP1-      -------------------------------------------------M
A0A2K6ASP2_BBC3-01      IKFGVGSARACPCQVPRASSATWVPCQICGPRERHGPRTPGGQLPGARRG
A0A2K6AYL7_HRK-01       -------------MCPCPLHRGRGPPAVC-------------ACSAGRLG
A0A2K6B5F6_BMF-03       -------------MEPSRCVEE---------------------LEDDVFQ
A0A2K6B5F6_BMF-01       -------------MEPSRCVEE---------------------LEDDVFQ
A0A2K6B5F6_BMF-02       -------------MEPSRCVEE---------------------LEDDVFQ
A0A2K6B5F6_BMF-04       -------------MEPSRCVEE---------------------LEDDVFQ
A0A2K6ASP2_BBC3-02      IKFGVGSARACPCQVPRASSATWVPCQIC-------------ETRGAAAT
A0A2K6ASP2_BBC3-03      IKFGVGSARACPCQVPRASSATWVPCQIC-------------GPQPSLLL
A0A2K6DBJ4_BIK-01       -----------MSGVRPISRDT------L-------------M-------
A0A2K6E7I4_BAD-01       -----------MFQIPEFEPSE------Q-------------E-------
A0A2K6E7I4_BAD-02       -----------MFQIPEFEPSE------Q-------------E-------
A0A2K6E7I4_BAD-03       -----------MFQIPEFEPSE------Q-------------E-------
A0A2K6BV43_PMAIP1-      -------------------------------------------------M
A0A2K6E1Z6_BCL2L11      -----------MAKQPSDVSSE------C-------------DREGRQLQ
A0A2K6E1Z6_BCL2L11      -----------MAKQPSDVSSE------C-------------DREGRQLQ
A0A2K6E1Z6_BCL2L11      -----------MAKQPSDVSSE------C-------------DREGRQLQ
A0A2K6E1Z6_BCL2L11      -----------MAKQPSDVSSE------C-------------DREGRQLQ
A0A2K6E1Z6_BCL2L11      -----------MAKQPSDVSSE------C-------------DREGRQLQ
A0A2K6E1Z6_BCL2L11      -----------MAKQPSDVSSE------C-------------DREGRQLQ
A0A2K6E1Z6_BCL2L11      -----------MAKQPSDVSSE------C-------------DREGRQLQ
A0A2K6E1Z6_BCL2L11      -----------MAKQPSDVSSE------C-------------DREGRQLQ
A0A2K6E1Z6_BCL2L11      -----------MAKQPSDVSSE------C-------------DREGRQLQ
A0A2K6E1Z6_BCL2L11      -----------MAKQPSDVSSE------C-------------DREGRQLQ
                                                                          

A0A2K6BV43_PMAIP1-      PG---KKARKNAQPS---------------------------------PT
A0A2K6ASP2_BBC3-01      PGPRRPAPLPARPPGALGSVLRPLRARPGCRPRRPRPAARCLPLRPHRPT
A0A2K6AYL7_HRK-01       LR---SSAAQLTAAR---------------------------------LK
A0A2K6B5F6_BMF-03       PE---DGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPT
A0A2K6B5F6_BMF-01       PE---DGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPT
A0A2K6B5F6_BMF-02       PE---DGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPT
A0A2K6B5F6_BMF-04       PE---DGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPT
A0A2K6ASP2_BBC3-02      PPLALEGPVQSHHGT---------------------------------P-
A0A2K6ASP2_BBC3-03      AE---QHLESPVPSA---------------------------------PG
A0A2K6DBJ4_BIK-01       -----ETLLYEQLLE---------------------------------PL
A0A2K6E7I4_BAD-01       -----DSSSAERGLG---------------------------------PS
A0A2K6E7I4_BAD-02       -----DSSSAERGLG---------------------------------PS
A0A2K6E7I4_BAD-03       -----DSSSAERGLG---------------------------------PS
A0A2K6BV43_PMAIP1-      PG---KKARKNAQPS---------------------------------PT
A0A2K6E1Z6_BCL2L11      PA---ERPPQLRPGA---------------------------------PT
A0A2K6E1Z6_BCL2L11      PA---ERPPQLRPGA---------------------------------PT
A0A2K6E1Z6_BCL2L11      PA---ERPPQLRPGA---------------------------------PT
A0A2K6E1Z6_BCL2L11      PA---ERPPQLRPGA---------------------------------PT
A0A2K6E1Z6_BCL2L11      PA---ERPPQLRPGA---------------------------------PT
A0A2K6E1Z6_BCL2L11      PA---ERPPQLRPGA---------------------------------PT
A0A2K6E1Z6_BCL2L11      PA---ERPPQLRPGA---------------------------------PT
A0A2K6E1Z6_BCL2L11      PA---ERPPQLRPGA---------------------------------PT
A0A2K6E1Z6_BCL2L11      PA---ERPPQLRPGA---------------------------------PT
A0A2K6E1Z6_BCL2L11      PA---ERPPQLRPGA---------------------------------PT
                                                                          

A0A2K6BV43_PMAIP1-      RAQAELEVEC----------------------------------------
A0A2K6ASP2_BBC3-01      RRHRHPGGPPLAWGSPQPAPRPTPGRSSALALAGGAAPGVARAQRPGGPG
A0A2K6AYL7_HRK-01       ALGDELHQRT----------------------------------------
A0A2K6B5F6_BMF-03       SQEDKATQTL----------------------------------------
A0A2K6B5F6_BMF-01       SQEDKATQTL----------------------------------------
A0A2K6B5F6_BMF-02       SQEDKATQTL----------------------------------------
A0A2K6B5F6_BMF-04       SQEDKATQTL----------------------------------------
A0A2K6ASP2_BBC3-02      ALTQGPQSPR----------------------------------------
A0A2K6ASP2_BBC3-03      ALAGGPTQAA----------------------------------------
A0A2K6DBJ4_BIK-01       TME-----------------------------------------------
A0A2K6E7I4_BAD-01       PAGDRPSDSG----------------------------------------
A0A2K6E7I4_BAD-02       PAGDRPSDSG----------------------------------------
A0A2K6E7I4_BAD-03       PAGDRPSDSG----------------------------------------
A0A2K6BV43_PMAIP1-      RAQAGPAGTA----------------------------------------
A0A2K6E1Z6_BCL2L11      SLQTEPQ-------------------------------------------
A0A2K6E1Z6_BCL2L11      SLQTDP--------------------------------------------
A0A2K6E1Z6_BCL2L11      SLQTEPQ-------------------------------------------
A0A2K6E1Z6_BCL2L11      SLQTEPQGNP----------------------------------------
A0A2K6E1Z6_BCL2L11      SLQTEPQGNP----------------------------------------
A0A2K6E1Z6_BCL2L11      SLQTEPQGNP----------------------------------------
A0A2K6E1Z6_BCL2L11      SLQTEPQGNP----------------------------------------
A0A2K6E1Z6_BCL2L11      SLQTEPQGNP----------------------------------------
A0A2K6E1Z6_BCL2L11      SLQTEPQGNP----------------------------------------
A0A2K6E1Z6_BCL2L11      SLQTEPQGNP----------------------------------------
                                                                          

A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K6ASP2_BBC3-01      GRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQRAIRAAETRGAAATPPL
A0A2K6AYL7_HRK-01       ---------------------MWRRRARSRRAPAPGALPTYWPWLCAAAQ
A0A2K6B5F6_BMF-03       ---------------------GPASPSQGVMLPCGVTEEPQRLFYAPAEP
A0A2K6B5F6_BMF-01       ---------------------GPASPSQGVMLPCGVTEEPQRLFYGNAGY
A0A2K6B5F6_BMF-02       ---------------------GPASPSQGVMLPCGVTEEPQRLFYGNAGY
A0A2K6B5F6_BMF-04       ---------------------GPASPSQGVMLPCGVTEEPQRLFYGNAGY
A0A2K6ASP2_BBC3-02      ---------------------NGAQLGA----------------------
A0A2K6ASP2_BBC3-03      ---------------------PGVRGEEEQWAREIGAQLRRMADDLNAQY
A0A2K6DBJ4_BIK-01       ------------------------------VLGVTDPEEDLDPMEDF---
A0A2K6E7I4_BAD-01       ---------------------KHHRQAPGLLWDASHQQEQPTSSSHHGGA
A0A2K6E7I4_BAD-02       ---------------------KHHRQAPGLLWDASHQQEQPTSSSHHGGT
A0A2K6E7I4_BAD-03       ---------------------KHHRQAPGLLWDASHQQEQPTSSSHHGGR
A0A2K6BV43_PMAIP1-      ---------------------GTARDQAG--------------------F
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      -----------------------------------------------GPF
A0A2K6E1Z6_BCL2L11      --------------------------------------------------
A0A2K6E1Z6_BCL2L11      ---------------------EGNHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K6E1Z6_BCL2L11      ---------------------EGNHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K6E1Z6_BCL2L11      ---------------------EGNHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K6E1Z6_BCL2L11      ---------------------EGNHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K6E1Z6_BCL2L11      ---------------------EGNHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K6E1Z6_BCL2L11      ---------------------EGNHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K6E1Z6_BCL2L11      ---------------------EGNHGGEGDSCPHGSPQGPLAPPASPGPF
                                                                          

A0A2K6BV43_PMAIP1-      --------------------------------------------------
A0A2K6ASP2_BBC3-01      ALEGPVQSHHGTPALTQGPQSPRNGAQLGACTRPVDVRDSGGRPLPPPDT
A0A2K6AYL7_HRK-01       VAALAAWLLGRRNL------------------------------------
A0A2K6B5F6_BMF-03       KSRVVADPPL---------------------------------PAQPCFE
A0A2K6B5F6_BMF-01       RLPLPASFPAVLPI----------------------------GEQPPEGQ
A0A2K6B5F6_BMF-02       RLPLPASFPAVLPI----------------------------GEQPPEGQ
A0A2K6B5F6_BMF-04       RLPLPASFPAVLPI----------------------------GEQPPEGQ
A0A2K6ASP2_BBC3-02      ------------------------------CTRPVDVRDSGGRPLPPPDT
A0A2K6ASP2_BBC3-03      ERRRQ-------------------------------EEQQRHRPSPWRVL
A0A2K6DBJ4_BIK-01       ---DPLECIEDSDMLALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAF
A0A2K6E7I4_BAD-01       ---GAVETRSRHSSYPAGT-----EEDEGMEEEPSPFRGRSRSAPPNLWA
A0A2K6E7I4_BAD-02       ---SSPEERGHSDADAAKL-----QLDASLPVLVGSELGQG---------
A0A2K6E7I4_BAD-03       AWYSPSWESEDSENPSARM-----LAEASARMSAPATDSEAQHAE-----
A0A2K6BV43_PMAIP1-      GIGMQLHYTRGKKLV---------------SSSPLVLPRGHEEQVQVARS
A0A2K6E1Z6_BCL2L11      ----------------------------DRSPAPMSCDKSTQTPSPPCQA
A0A2K6E1Z6_BCL2L11      ATRSP-------------------------------CDKSTQTPSPPCQA
A0A2K6E1Z6_BCL2L11      ----------------------------DRSPAPMSCDKSTQTPSPPCQA
A0A2K6E1Z6_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
A0A2K6E1Z6_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
A0A2K6E1Z6_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
A0A2K6E1Z6_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
A0A2K6E1Z6_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
A0A2K6E1Z6_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
A0A2K6E1Z6_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
                                                                          

A0A2K6BV43_PMAIP1-      -------------------------ATQLRRFGDKLNFRQKLLNLIAKLF
A0A2K6ASP2_BBC3-01      LASAGDFLCTM---------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------------------
A0A2K6B5F6_BMF-03       WRR-----------------------------------------------
A0A2K6B5F6_BMF-01       WQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVWWQILLFLHNLALNG
A0A2K6B5F6_BMF-02       WQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVWWQILLFLHNLALNG
A0A2K6B5F6_BMF-04       WQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVWWQILLFLHNLALNG
A0A2K6ASP2_BBC3-02      LASAGDFLCTM---------------------------------------
A0A2K6ASP2_BBC3-03      YNLIMGLLPLPRGHRAPEMEPN----------------------------
A0A2K6DBJ4_BIK-01       IYDQMDDI----RDVLRSFMDGFTTL-----RENIMRFWRSPNPRSWVS-
A0A2K6E7I4_BAD-01       AQRYGREL----RRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQS
A0A2K6E7I4_BAD-02       ------KL----RTLPVTFAPRPETPPALTVLVGHLGYGRKCFPQALCK-
A0A2K6E7I4_BAD-03       ----NVKL----KALGL-WRPAVATAPTPRGRRRTKGWRRSPAPFGAARA
A0A2K6BV43_PMAIP1-      RVCYSTQEIWRQTKLPAETSESDSQTLLLRNLTASKTCIRGLQKRLFLRR
A0A2K6E1Z6_BCL2L11      FNHYLSAMVVI-----------------LEDIGDSSLWFGFIFTGLDLYG
A0A2K6E1Z6_BCL2L11      FNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDE--FNAYYARRVFLNN
A0A2K6E1Z6_BCL2L11      FNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDE--FNAYYARRVFLNN
A0A2K6E1Z6_BCL2L11      FNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDE--FNAYYARRVFLNN
A0A2K6E1Z6_BCL2L11      FNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDE--FNAYYARRVFLNN
A0A2K6E1Z6_BCL2L11      FNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDE--FNAYYARRMSLPP
A0A2K6E1Z6_BCL2L11      FNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDE--FNAYYARRLEK--
A0A2K6E1Z6_BCL2L11      FNHYLSAMVREIEEVVV---------------------------------
A0A2K6E1Z6_BCL2L11      FNHYLSAMGIFE--------------------------------------
A0A2K6E1Z6_BCL2L11      FNHYLSAMANWD--------------------------------------
                                                                          

A0A2K6BV43_PMAIP1-      CSGT----------------------------------
A0A2K6ASP2_BBC3-01      --------------------------------------
A0A2K6AYL7_HRK-01       --------------------------------------
A0A2K6B5F6_BMF-03       EQERGGP-------------------------------
A0A2K6B5F6_BMF-01       EENRNGAGPR----------------------------
A0A2K6B5F6_BMF-02       EENRNGAGPR----------------------------
A0A2K6B5F6_BMF-04       EENRNGAGPR----------------------------
A0A2K6ASP2_BBC3-02      --------------------------------------
A0A2K6ASP2_BBC3-03      --------------------------------------
A0A2K6DBJ4_BIK-01       -------REQVLLVLLLLLALLLALLSGGLHLLLK---
A0A2K6E7I4_BAD-01       WWDRNLGRGSS-----------APSQ------------
A0A2K6E7I4_BAD-02       -------RGSV-----------LPLSVGGLTQIPFRCM
A0A2K6E7I4_BAD-03       PRPPTSGQHSV-----------MAASSGG---------
A0A2K6BV43_PMAIP1-      CTLHQFEERLH-----------CNW-------------
A0A2K6E1Z6_BCL2L11      HHHSQDTEQLN-----------HKDFS-----------
A0A2K6E1Z6_BCL2L11      YQAAEDHPQMV-----------ILRLLRYIVRLVWRMH
A0A2K6E1Z6_BCL2L11      YQAAEDHPQMV-----------ILRLLRYIVRLVWRMH
A0A2K6E1Z6_BCL2L11      YQAAEDHPQMV-----------ILRLLRYIVRLVWRMH
A0A2K6E1Z6_BCL2L11      YQAAEDHPQMV-----------ILRLLRYIVRLVWRMH
A0A2K6E1Z6_BCL2L11      D-------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------
A0A2K6E1Z6_BCL2L11      --------------------------------------
                                                              

© 1998-2022Legal notice