Dataset for protein Bad of organism Macaca nemestrina

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
***************************************************************    ..       .  .
                                                               a    ap   ed dada

        90       100       110       120       130       140       150       160
*    : .      .  . .               :*. :   :       *            ..       .      
 kmleeeglpmlpppflsqgrs-ppnlwaaqrynve krmpltwrdrpegl rlrslrrhlqwgqkpfwqglcqswwprt
 glea   aeeeagaed eaqh e         gr   a gde a afa a a kgaggak m   ca faaakaprdpn

       170       180  
  . *  . .            
s-qh slalqv--ltqipfrcm
    a a s           
© 1998-2022Legal notice