Dataset for protein Bad of organism Macaca nemestrina

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2K6E7I4_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Macaca nemestrina GN=BAD (length=163 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGRAWYSPSWESEDSENPS
ARMLAEASARMSAPATDSEAQHAENVKLKALGLWRPAVATAPTPRGRRRTKGWRRSPAPFGAARAPRPPTSGQHSVMAAS
SGG
>gnl|bcl2dbpro|A0A2K6E7I4_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Macaca nemestrina GN=BAD (length=156 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGTSSPEERGHSDADAAKL
QLDASLPVLVGSELGQGKLRTLPVTFAPRPETPPALTVLVGHLGYGRKCFPQALCKRGSVLPLSVGGLTQIPFRCM
© 1998-2020Legal notice