Dataset for protein classical BH3-containing proteins of organism Macaca fascicularis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                       *                                                        
------------messraervlqPsptrpqsrpggptstql----lld----eeqptpsghhgg--------e---s--l
mfqmpkqpsdvssvgklerkqfg eerearpsdssslhrdafrql---cslsrp-lnsltnl--pplrstsq-req-qt-
 sgiaefmpssrepees-gdnae adgpdglq-aakhglatrpgsvwlapmqqlygf-es-ccstgwypppgvmkdtenw
   vrpieepeqcdcdkydqgqv rtag--a-s---c-a--qaygrkgvthp--v-dg-kl-srsktvnsreqdgavdvp
       srktl----- -ple  lassgt-vqevt-l- r slagferrdeshfv-ap-gvp rasqlalwhsrhessf
        i fgvgtl  cme     m   wglcqinaw p df de qh  l dts medfa g  ag atce e  qd
               a    c     f    e  pea p       a ig  d   r k a       a         ma
                                                          f                   a 

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
a-rl-----eldcsltgspqr-lsep--------rslll-f-----------rr-----------------r--------
-r--psqgvrmpsgvrepaegp----aspgppat--pp-i-iygsqppirgw--sstlprstsryfsfdtd-spapqscd
rpksqywwdmgwacphae--alfypvqqyrsfkpat--fvlptdqmtlpgqmqkremvsttsllqrimrywhrwnvmqwv
gaavlnstrqnlvrgs--ys-traqs hrkrvvlwrvgytwlmaplqdefevphpalprnprvgvntlgwrcnlh rglq
tsvmgcllqlifrqtpvqvptseqgn gahnrsvqdf vrn i lkdcc drlgvlfeqil khrghk qh kcf fahc
sqeicaiiakaegdanslrlsrdgdg e el lmka  an    ea     l a fedgfc g ecee lg       aa
 l fa      ad  ema gqq  ae        h    a           h     a aa      a ff         
                l    e   a                         a                            

       170       180       190       200       210       220 
....:....|....:....|....:....|....:....|....:....|....:....|.
                                                             
-------------------------------------------------------------
kstqtpspprqsvnhylslmgereralssggltqirkrqmlrrigdefnayyarrmslppd
snrrrvwwqclafllv lanlsqrlpgpvprrpllpiace                     
rapnp tsgqhq   n a lailnqnelgdm he lf                        
q        igl         aflmgaaa                                
          e           e                                      
                                                             
                                                             
© 1998-2020Legal notice