Dataset for protein classical BH3-containing proteins of organism Macaca fascicularis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfpaaaagaarargaacgtlgcpaecggglagrrglcaapgtlnpspelcflrclrgdgqgapgrrrararrpgararar
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------makqpsdvssecdregrqlqpaer-ppqlrPgaptslqtepq------------------------
tlrsegkartkkdq-----------ledd--vf-aedgyevgsqrsssltadlfa-gnpegnhggegdscphgspqgpla
               eme  rcver----vpsaw-spt rse-- rtrefvwsa-r lgpspa nr              
                e   pfrmpsksarln-r mqq qr-vg meqsdtsvtrg                        
                       g irkgpk- c kge ma fe i dgasmepkd                        
                         g f mg    cfc i  a    ad  g  e                         
                                       g              c                         
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                   .                            
-----------------------------------g------drsp----apmscd-----kstqtpsppcqafnhyls-
ppaspgpfatrsplflfdcplsrmqrssllsrsgs-yfstdtedkatqtlgsagpsmrpeiqgvmllcgvtrepqrlfyv
  sds khhrqa gsil ashqqlrlfpsthccspslrpfsqrlrspvssyalvta     rdstqsaswve----w-d 
              l y      e ptepstgpvl vvlpeslsermepfs gplp     eqprmqvrrs-vrvs-y- 
                w         l  qcmgqi mtehyehpdkl d q eeam     timgeerqildsigqewt 
                             iahf a aqdar ah      k  a e     g he aelggaceed sr 
                                e    l     g      d            ed   e a    c ma 
                                                               a           a a  
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--a--r---pa-------------------r-e------------riaqelrrigdefnay--------r-------q--
am-sr-qae--dmpavlpigeqppegqwqh-p-ilglafiydqmdqm-rk-qcmasqshrlrlnitrya-rvslnny-qh
gnrgyslpllssf                 wahv           a-g--iwsatgs-t--gkifmglyesrfqhhvvaa
sl ap rsq pnv                 amas           eyvvvgseqselplwtffg   fwlyprptsqtrw
pf      a  el                    q           drrgr edlpagl-tsae     s pmnkrtwltr
                                              nldq d fm d vgq       p  lhhprldsn
                                                ai a  l   aei       d  keagpe  m
                                                           df          g  eld  e
                                                                       d   ea   

       330       340       350       360    
....:....|....:....|....:....|....:....|....
                                            
-q----v----------l--------------------------
q-npqr-ilrlllylvn-vwrmhenrngagprpnwwngavvkpc
edhrnmtwwqisrfihrfarngelpsqeprlhclt         
rlsslwssynqqwwdrp slgstalqm en              
ptvwkvllvl imr ll pg ls hlk                 
lpelwtfrrg akl a  l  hr  ef                 
  ahsdc  f   g    g  c                      
     a                                      
                                            
© 1998-2022Legal notice