Dataset for protein classical BH3-containing proteins of organism Macaca fascicularis

[Download (right click)] [Edit] [Sequences] [Repertoires]

16 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5V8L0_BBC3-01      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A7N9CRT3_BMF-02       --------------------------------------------------
A0A7N9CRT3_BMF-01       --------------------------------------------------
A0A7N9CRT3_BMF-03       --------------------------------------------------
A0A2K5VCA1_BAD-01       --------------------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      MFPAAAAGAARARGAACGTLGCPAECGGGLAGRRGLCAAPGTLNPSPELC
A0A2K5X1Y3_BCL2L11      MFPAAAAGAARARGAACGTLGCPAECGGGLAGRRGLCAAPGTLNPSPELC
Q2PG01_BAD-01           --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
                                                                          

A0A2K5V8L0_BBC3-01      --------------------------------------------------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
A0A7N9CRT3_BMF-02       ----------------------------------------------MEPS
A0A7N9CRT3_BMF-01       ----------------------------------------------MEPS
A0A7N9CRT3_BMF-03       ----------------------------------------------MEPS
A0A2K5VCA1_BAD-01       --------------------------------------------------
A0A2K5VW94_BIK-01       --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------MAKQPS
A0A2K5X1Y3_BCL2L11      --------------------------------------------MAKQPS
A0A2K5X1Y3_BCL2L11      --------------------------------------------MAKQPS
A0A2K5X1Y3_BCL2L11      FLRCLRGDGQGAPGRRRARARRPGARARARTLRSEGKARTKKDQMAKQPS
A0A2K5X1Y3_BCL2L11      FLRCLRGDGQGAPGRRRARARRPGARARARTLRSEGKARTKKDQMAKQPS
Q2PG01_BAD-01           --------------------------------------------MEEEPS
A0A2K5X1Y3_BCL2L11      --------------------------------------------MAKQPS
A0A2K5X1Y3_BCL2L11      --------------------------------------------MAKQPS
A0A2K5X1Y3_BCL2L11      --------------------------------------------MAKQPS
                                                                          

A0A2K5V8L0_BBC3-01      -----IKFGVGSARACPC-QV---PRASSATWVPCQ--------------
A0A2K5VPX2_PMAIP1-      ---MPGKKARKNAQPSPT-RAQAGPGTAGTAGTARD--------------
A0A7N9CRT3_BMF-02       RCVEELEDD--VFQPEDG-EPGSQPGSSLSADLFAQ--------------
A0A7N9CRT3_BMF-01       RCVEELEDD--VFQPEDG-EPGSQPGSSLSADLFAQ--------------
A0A7N9CRT3_BMF-03       RCVEELEDD--VFQPEDG-EPGSQPGSSLSADLFAQ--------------
A0A2K5VCA1_BAD-01       ---------------MFQ-IPEFEPSEQEDSSSAERGLGPSPAGNR----
A0A2K5VW94_BIK-01       ---------MLSFCPKGE-MSGVRPISRDTLMET----------------
A0A2K5X1Y3_BCL2L11      DVSSECDREGRQLQPAER-PPQLRPGAPTSLQTEPQGNPEGNHGGEGDSC
A0A2K5X1Y3_BCL2L11      DVSSECDREGRQLQPAER-PPQLRPGAPTSLQTEPQGNPEGNHGGEGDSC
A0A2K5X1Y3_BCL2L11      DVSSECDREGRQLQPAER-PPQLRPGAPTSLQTEPQGNPEGNHGGEGDSC
A0A2K5X1Y3_BCL2L11      DVSSECDREGRQLQPAER-PPQLRPGAPTSLQTEPQ--------------
A0A2K5X1Y3_BCL2L11      DVSSECDREGRQLQPAER-PPQLRPGAPTSLQTEPQGNPEGNHGGEGDSC
Q2PG01_BAD-01           PFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKG--------------
A0A2K5X1Y3_BCL2L11      DVSSECDREGRQLQPAER-PPQLRPGAPTSLQTEPQ--------------
A0A2K5X1Y3_BCL2L11      DVSSECDREGRQLQPAER-PPQLRPGAPTSLQTEPQ--------------
A0A2K5X1Y3_BCL2L11      DVSSECDREGRQLQPAER-PPQLRPGAPTSLQTEPQ--------------
                                                                          

A0A2K5V8L0_BBC3-01      ---------------------------------------ICGPQPSLLLA
A0A2K5VPX2_PMAIP1-      ---------------------------------------QAGFGIGMQLH
A0A7N9CRT3_BMF-02       ------------------------SLLDCPLSRLQLFPLTHCCGPGLRPT
A0A7N9CRT3_BMF-01       ------------------------SLLDCPLSRLQLFPLTHCCGPGLRPT
A0A7N9CRT3_BMF-03       ------------------------SLLDCPLSRLQLFPLTHCCGPGLRPT
A0A2K5VCA1_BAD-01       -----------PSDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVET
A0A2K5VW94_BIK-01       ------------------------LLY------EQLLEPLTMEVLGVTDP
A0A2K5X1Y3_BCL2L11      PHGSPQGPLAPPASPGPFATRSPLFIF------MRRSSLLSRSSSGYFSF
A0A2K5X1Y3_BCL2L11      PHGSPQGPLAPPASPGPFATRSPLFIF------MRRSSLLSRSSSGYFSF
A0A2K5X1Y3_BCL2L11      PHGSPQGPLAPPASPGPFATRSPLFIF------MRRSSLLSRSSSGYFSF
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      PHGSPQGPLAPPASPGPFATRSPLFIF------MRRSSLLSRSSSGYFSF
Q2PG01_BAD-01           --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
                                                                          

A0A2K5V8L0_BBC3-01      EQHLESPVPSAPGALA-----GGPTQAAPGVREEEQWAR-----------
A0A2K5VPX2_PMAIP1-      YTRGKKLVSSSPLVLP-----RGHEEQVQVARSRVCYST-----------
A0A7N9CRT3_BMF-02       SQEDKATQTLGPASPS-----QGVMLPCGVTEEPQRLFY-GNAGYRLPLP
A0A7N9CRT3_BMF-01       SQEDKATQTLGPASPS-----QGVMLPCGVTEEPQRLFY-GNAGYRLPLP
A0A7N9CRT3_BMF-03       SQEDKATQTLGPASPS-----QGVMLPCGVTEEPQRLFY-GNAGYRLPLP
A0A2K5VCA1_BAD-01       RSRHSS----YPAGTE-----EDEGMEEEPS---------PFRGRSRSAP
A0A2K5VW94_BIK-01       EEDLDPMEDFDPLECM-----EDSDMLALRLACIGDEMDVSLRAPRLAQL
A0A2K5X1Y3_BCL2L11      DTDRSP----APMSCD-----KSTQTPSPPCQAFNHYLS-AMASRRQAEP
A0A2K5X1Y3_BCL2L11      DTDRSP----APMSCD-----KSTQTPSPPCQAFNHYLS-AMASRRQAEP
A0A2K5X1Y3_BCL2L11      DTDRSP----APMSCD-----KSTQTPSPPCQAFNHYLS-AMASRRQAEP
A0A2K5X1Y3_BCL2L11      --DRSP----APMSCD-----KSTQTPSPPCQAFNHYLS-AMASRRQAEP
A0A2K5X1Y3_BCL2L11      DTDRSP----APMSCD-----KSTQTPSPPCQAFNHYLS-AMASRRQAEP
Q2PG01_BAD-01           --LPRP----KSAGTA-----TQMRQSSSWTRVFQSWWD-RNLGRGSSAP
A0A2K5X1Y3_BCL2L11      --ASRR----QAEPADMRPEIRIAQELRRIGDEFNAYYA-RR---LAELL
A0A2K5X1Y3_BCL2L11      --DRSP----APMSCD-----KSTQTPSPPCQAFNHYLS-AMVVILEDIG
A0A2K5X1Y3_BCL2L11      --DRSP----APMSCD-----KSTQTPSPPCQAFNHYLS-AM----DEAT
                                   .                                      

A0A2K5V8L0_BBC3-01      -----------------------------------EIGAQLRRMADDLNA
A0A2K5VPX2_PMAIP1-      -----------------------------------Q---EIWRQTELPAE
A0A7N9CRT3_BMF-02       ASFPAVLPIGEQPPEGQWQHRAEV-----------QIARKLQCIADQFHR
A0A7N9CRT3_BMF-01       ASFPAVLPIGEQPPEGQWQHRAEV-----------QIARKLQCIADQFHR
A0A7N9CRT3_BMF-03       ASFPAVLPIGEQPPEGQWQHRAEV-----------QIARKLQCIADQFHR
A0A2K5VCA1_BAD-01       PNL-----------------WAAQ-----------RYGRELRRMSDEFVD
A0A2K5VW94_BIK-01       SEV-----------------AMHSLGLAFIYDQMDDIRDVLRSFMDGFTT
A0A2K5X1Y3_BCL2L11      ADM-----------------RPEI-----------RIAQELRRIGDEFNA
A0A2K5X1Y3_BCL2L11      ADM-----------------RPEI-----------RIAQELRRIGDEFNA
A0A2K5X1Y3_BCL2L11      ADM-----------------RPEI-----------RIAQELRRIGDEFNA
A0A2K5X1Y3_BCL2L11      ADM-----------------RPEI-----------RIAQELRRIGDEFNA
A0A2K5X1Y3_BCL2L11      ADM-----------------RPEI-----------RIAQELRRIGDEFNA
Q2PG01_BAD-01           SQ------------------------------------------------
A0A2K5X1Y3_BCL2L11      ASST----------------------------------------------
A0A2K5X1Y3_BCL2L11      DSSLWFGFIFTGLDLYGHHHSQDTEQLNHKDFS-----------------
A0A2K5X1Y3_BCL2L11      GSSLGIAL-----------HREVQWPLEWLASS-----------------
                                                                          

A0A2K5V8L0_BBC3-01      QYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN-------
A0A2K5VPX2_PMAIP1-      TSESDSQTLLLRNLTASKTCIRGLQKRL--FLRRCTLHQFEERLHCNW--
A0A7N9CRT3_BMF-02       L--------------HV---QQNRNRVWWQILLFLHNLALNGEENRNGAG
A0A7N9CRT3_BMF-01       L--------------HVQQHQQNRNRVWWQILLFLHNLALNGEENRNGAG
A0A7N9CRT3_BMF-03       L--------------HVQQHQQNRNRVWWQILLFLHNLALNGEENRNGAG
A0A2K5VCA1_BAD-01       SFKG---LPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ---
A0A2K5VW94_BIK-01       LRENIMRFWRSPNPRSWVSREQVLLVLLLLLALLLALLSGGLHLLLK---
A0A2K5X1Y3_BCL2L11      Y------YARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH-------
A0A2K5X1Y3_BCL2L11      Y------YARRLEK------------------------------------
A0A2K5X1Y3_BCL2L11      Y------YARRMSLPPD---------------------------------
A0A2K5X1Y3_BCL2L11      Y------YARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH-------
A0A2K5X1Y3_BCL2L11      Y------YARRVFLNNYQAAEDHPQMVILRLLRYIVRLVWRMH-------
Q2PG01_BAD-01           --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      --------------------------------------------------
                                                                          

A0A2K5V8L0_BBC3-01      --------------
A0A2K5VPX2_PMAIP1-      --------------
A0A7N9CRT3_BMF-02       PR------------
A0A7N9CRT3_BMF-01       PR------------
A0A7N9CRT3_BMF-03       PRPLTWNGAVVKPC
A0A2K5VCA1_BAD-01       --------------
A0A2K5VW94_BIK-01       --------------
A0A2K5X1Y3_BCL2L11      --------------
A0A2K5X1Y3_BCL2L11      --------------
A0A2K5X1Y3_BCL2L11      --------------
A0A2K5X1Y3_BCL2L11      --------------
A0A2K5X1Y3_BCL2L11      --------------
Q2PG01_BAD-01           --------------
A0A2K5X1Y3_BCL2L11      --------------
A0A2K5X1Y3_BCL2L11      --------------
A0A2K5X1Y3_BCL2L11      --------------
                                      

© 1998-2022Legal notice