Dataset for protein classical BH3-containing proteins of organism Macaca fascicularis

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5VLE9_BMF-01       -------MEPSRCVEELEDDVFQPEDGEPGSQPGSSLSADLFAQSLLDCP
A0A2K5VLE9_BMF-02       -------MEPSRCVEELEDDVFQPEDGEPGSQPGSSLSADLFAQSLLDCP
A0A2K5VPX2_PMAIP1-      ------------MPGKKARKNAQPSPTRAQAGQAGTAGTAR-DQAGFGIG
A0A2K5V8J3_BBC3-03      --------IKFGVGSARACPCQVPRASSATWVPCQICGPQP-SLLLAEQH
A0A2K5X1Y3_BCL2L11      ---MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQT---------
A0A2K5X1Y3_BCL2L11      ---MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQT---------
A0A2K5VW94_BIK-01       MSGVRPISRDTLMETLLYEQLLEPLTME-----------------VLGVT
A0A2K5VCA9_BAD-02       MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQA-PGLLWDAS
A0A2K5VCA9_BAD-03       MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQA-PGLLWDAS
A0A2K5VPX2_PMAIP1-      ------------MPGKKARKNAQPSPTRAQAELEVECATQLRRFGDKL--
Q2PG01_BAD-01           -------------------MEEEPSPFRGRSRSAPPNLWAAQRYGRELRR
                                               *                          

A0A2K5VLE9_BMF-01       LSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQ
A0A2K5VLE9_BMF-02       LSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQ
A0A2K5VPX2_PMAIP1-      MQLHYTRGKKLVSSSPLVLPRGHEEQVQVARSRVCYSTQEIWRQTELPAE
A0A2K5V8J3_BBC3-03      LESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYE
A0A2K5X1Y3_BCL2L11      --EPQGNPEGNHGG-------------------------EGDSCPHGSPQ
A0A2K5X1Y3_BCL2L11      --EPQGNPEGNHGG-------------------------EGDSCPHGSPQ
A0A2K5VW94_BIK-01       DPEEDLDPMEDF------NPLECMEDSDMLALRLACIGDEMDVSLRAPRL
A0A2K5VCA9_BAD-02       HQQEQPTSSSHHGGT---SSPEERGHSDADAAKL-----QLDASLPVLVG
A0A2K5VCA9_BAD-03       HQQEQPTSSSHHGGRAWYSPSWESEDSENPSARM-----LAEASARMSAP
A0A2K5VPX2_PMAIP1-      ----------------------------NFRQKLLNLIAKLFCSGT----
Q2PG01_BAD-01           MSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPS
                                                                          

A0A2K5VLE9_BMF-01       RLFYAPAEPKSRVVADPPL-----PAQPCFEWRR----------------
A0A2K5VLE9_BMF-02       RLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQ
A0A2K5VPX2_PMAIP1-      TSESDS--------QTLLLRNLTASKTCIRGLQKRLFLRRCTLHQFEERL
A0A2K5V8J3_BBC3-03      RRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN----------
A0A2K5X1Y3_BCL2L11      GPLAPPASPGPFATRSPLFIF----------MRRSSLLSRSSSGYFSFDT
A0A2K5X1Y3_BCL2L11      GPLAPPASPGPFATRSPLFIF----------MRRSSLLSRSSSGYFSFDT
A0A2K5VW94_BIK-01       AQLSEV------AMHSLGLAFIYDQMDDIRDVLRSFMDGFTTLRENIMRF
A0A2K5VCA9_BAD-02       SELGQG------KLRTLPVTF----------APRPETPPALTVLVGHLGY
A0A2K5VCA9_BAD-03       ATDSEAQHAENVKLKALGL-W----------RPGVATAPTPRGRRRTKGW
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
Q2PG01_BAD-01           Q-------------------------------------------------
                                                                          

A0A2K5VLE9_BMF-01       -------------------------------EQERGGP------------
A0A2K5VLE9_BMF-02       FHRLHVQQHQQNRNRVWWQILLFLHNLALNGEENRNGAGPR---------
A0A2K5VPX2_PMAIP1-      HCNW----------------------------------------------
A0A2K5V8J3_BBC3-03      --------------------------------------------------
A0A2K5X1Y3_BCL2L11      DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE----------------
A0A2K5X1Y3_BCL2L11      DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQAEPADMRPEIRIAQE
A0A2K5VW94_BIK-01       WRSPNPRSWVS--------REQVLLVLLLLLALLLALLSGGLHLLLK---
A0A2K5VCA9_BAD-02       GRKCFPQALCK--------RGSV-----------LPLSVGGLTQIPFRCM
A0A2K5VCA9_BAD-03       RRSPAPFGAARAPRPPTSGQHSV-----------MAASSGG---------
A0A2K5VPX2_PMAIP1-      --------------------------------------------------
Q2PG01_BAD-01           --------------------------------------------------
                                                                          

A0A2K5VLE9_BMF-01       ---------------------
A0A2K5VLE9_BMF-02       ---------------------
A0A2K5VPX2_PMAIP1-      ---------------------
A0A2K5V8J3_BBC3-03      ---------------------
A0A2K5X1Y3_BCL2L11      ---------------------
A0A2K5X1Y3_BCL2L11      LRRIGDEFNAYYARRMSLPPD
A0A2K5VW94_BIK-01       ---------------------
A0A2K5VCA9_BAD-02       ---------------------
A0A2K5VCA9_BAD-03       ---------------------
A0A2K5VPX2_PMAIP1-      ---------------------
Q2PG01_BAD-01           ---------------------
                                             

© 1998-2020Legal notice