Dataset for protein Bad of organism Macaca fascicularis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfqipefepseqedsssaerglgpspagnrpsdsgkhhrqapgllwdashqqeqptssshhggagavetrsrhssypagt

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     ***************************************************************************
-----MEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGR
eedeg                                                                           

       
....:..
*******
GSSAPSQ
       
© 1998-2022Legal notice