Dataset for protein Bad of organism Macaca fascicularis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                            : **    . *.**  ** *..            *                 
mfqipefepseqedsssaerglgpspagdrPSdsgkhhRqAPglLWdAshqqeqptssshhgGr---s---e---s----
--------------------------meee  pfrgrs s  pn  a qry----------- tawy-ssw-sgh-enps
                                                                    ppe red dada

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                          :*. :   :       *            ..       .        . *  . 
a-----as------------------kLrtlsv-fvpsvktpPtptvrvtttgyrrsssptrvfr-------grgSvmps
-rmqle--lrvsvpstlsqgqhaenve krmpltwrdrpegl rlrslrrhlqwgqkpfwqglcqswwprts-qh slal
 kllad  apmlagaedgea         a gde a gfa a a kgaggak m   ca faaakaprdpnl     a a

       170   
....:....|...
.            
s-gg---------
qv--ltqipfrcm
 s           
© 1998-2020Legal notice