Dataset for protein Bad of organism Macaca fascicularis

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q2PG01_BAD-01          --------------------------MEEEPSPFRGRSRSAPPNLWAAQR
A0A2K5VCA9_BAD-02      MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASH
A0A2K5VCA9_BAD-03      MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASH
                                                   : **    . *.**  ** *..

Q2PG01_BAD-01          Y-----------GR------------------------------------
A0A2K5VCA9_BAD-02      QQEQPTSSSHHGGT---SSPEERGHSDADAAKLQLDASLPVLVGSELGQG
A0A2K5VCA9_BAD-03      QQEQPTSSSHHGGRAWYSPSWESEDSENPSARMLAEASARMSAPATDSEA
                                   *                                     

Q2PG01_BAD-01          ------ELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDR
A0A2K5VCA9_BAD-02      ------KLRTLPVTFAPRPETPPALTVLVGHLGYGRKCFPQALCK-----
A0A2K5VCA9_BAD-03      QHAENVKLKALGL-WRPGVATAPTPRGRRRTKGWRRSPAPFGAARAPRPP
                             :*. :   :       *            ..       .     

Q2PG01_BAD-01          NLGRGSSAPSQ------------
A0A2K5VCA9_BAD-02      ---RGSVLPLSVGGLTQIPFRCM
A0A2K5VCA9_BAD-03      TSGQHSVMAASSGG---------
                          . *  . .            

© 1998-2020Legal notice