Dataset for protein Bim of organism Lynx canadensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************************************                                       
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQgnpegegdrcpqgspqgplappaspgpfatrsplfifvr
                                         ---------------------------------------
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                               . :                              
rssllsrsssgyfsfdtdrspapmscdkstqtpsppcqafnhylsamasmrqpqavpadmrpeiwiaqelrrigdefnay
-----------------------------------------------glfe-----------------------------
                                                                                
                                                                                

       170       180       190      
....:....|....:....|....:....|....:.
                                    
yprrvfl-----------------------------
----l--nnyqaaeaqpqmiilrllryivrlvwrlq
    -ervpasyi                       
     aq                             
© 1998-2020Legal notice