Dataset for protein Bim of organism Lynx canadensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A667H9R7_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQ---------
A0A667H9R7_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQ---------
A0A667H9R7_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDR
A0A667H9R7_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDR
A0A667H9R7_BCL2L11      MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDR
                        *****************************************         

A0A667H9R7_BCL2L11      --------------------------------------------------
A0A667H9R7_BCL2L11      -----------------------------------------------DRS
A0A667H9R7_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
A0A667H9R7_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
A0A667H9R7_BCL2L11      CPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRS
                                                                          

A0A667H9R7_BCL2L11      ---------------------------ASMRQPQAVPADMRPEIWIAQEL
A0A667H9R7_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQEL
A0A667H9R7_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMGLFE-------------------
A0A667H9R7_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQEL
A0A667H9R7_BCL2L11      PAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQPQAVPADMRPEIWIAQEL
                                                   . :                    

A0A667H9R7_BCL2L11      RRIGDEFNAYYPRRLARVPASYI-----------------------
A0A667H9R7_BCL2L11      RRIGDEFNAYYPRRVFLNNYQAAEAQPQMIILRLLRYIVRLVWRLQ
A0A667H9R7_BCL2L11      ----------------------------------------------
A0A667H9R7_BCL2L11      RRIGDEFNAYYPRRLEQ-----------------------------
A0A667H9R7_BCL2L11      RRIGDEFNAYYPRRVFLNNYQAAEAQPQMIILRLLRYIVRLVWRLQ
                                                                      

© 1998-2020Legal notice