Dataset for protein Bmf of organism Leptobrachium leishanense

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    ****************************************************************************
----MEQESFLSSDELDDDVFYPDDFEFSLPPLTPPSPFIQKYTSFFGRFHLFPLSHCCGPGCRSADSEDKATQTLGSPS
msyr                                                                            

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
VSMNAMLPCGVTESPQRLFYGNAGYMLQHPARSPSLLRDHLTRGRQEQSAERRIARKLQCIGDQFHRLHLQKLQQNRNQV
                                                                                

       170       180     
....:....|....:....|....:
*************************
WSQIFFFFRNLVIQNERNRGEVNWR
                         
© 1998-2022Legal notice