Dataset for protein Bmf of organism Leptobrachium leishanense

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C5R6G2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Leptobrachium leishanense GN=BMF (length=185 residues).
MSYRMEQESFLSSDELDDDVFYPDDFEFSLPPLTPPSPFIQKYTSFFGRFHLFPLSHCCGPGCRSADSEDKATQTLGSPS
VSMNAMLPCGVTESPQRLFYGNAGYMLQHPARSPSLLRDHLTRGRQEQSAERRIARKLQCIGDQFHRLHLQKLQQNRNQV
WSQIFFFFRNLVIQNERNRGEVNWR
>gnl|bcl2dbpro|A0A8C5R6G2_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Leptobrachium leishanense GN=BMF (length=181 residues).
MEQESFLSSDELDDDVFYPDDFEFSLPPLTPPSPFIQKYTSFFGRFHLFPLSHCCGPGCRSADSEDKATQTLGSPSVSMN
AMLPCGVTESPQRLFYGNAGYMLQHPARSPSLLRDHLTRGRQEQSAERRIARKLQCIGDQFHRLHLQKLQQNRNQVWSQI
FFFFRNLVIQNERNRGEVNWR
© 1998-2022Legal notice