Dataset for protein Bim of organism Laticauda laticaudata

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MAKQSPDLNSECEREGGQLQPAERPAQPHHLRPGAPTSLQTEYQGNHLGERDSSSPGSPQGPLAPPSSPSPFATRSPLFM
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
FVRRSPLLSRSSSGYFSFDIDRSPAPMNCDKATQTPSPPCQAINHYLSAMGKQEHASRWQSRPIPEDMQPEIWIAQELRR
                                                                                

       170       180       190       200       210         
....:....|....:....|....:....|....:....|....:....|....:....
*************                 * *.    :.   :*.* * :  :     
IGDEFNASYCPRR-----------------GlLsyytvnrqkqmLrLlHylvyw-----
             vtfnifivlnsfayssd a dtqgkdhgiii h e linrfiwrmq
© 1998-2022Legal notice