Dataset for protein Bim of organism Laticauda laticaudata

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C5STS5_BCL2L11      MAKQSPDLNSECEREGGQLQPAERPAQPHHLRPGAPTSLQTEYQGNHLGE
A0A8C5STS5_BCL2L11      MAKQSPDLNSECEREGGQLQPAERPAQPHHLRPGAPTSLQTEYQGNHLGE
                        **************************************************

A0A8C5STS5_BCL2L11      RDSSSPGSPQGPLAPPSSPSPFATRSPLFMFVRRSPLLSRSSSGYFSFDI
A0A8C5STS5_BCL2L11      RDSSSPGSPQGPLAPPSSPSPFATRSPLFMFVRRSPLLSRSSSGYFSFDI
                        **************************************************

A0A8C5STS5_BCL2L11      DRSPAPMNCDKATQTPSPPCQAINHYLSAMGKQEHASRWQSRPIPEDMQP
A0A8C5STS5_BCL2L11      DRSPAPMNCDKATQTPSPPCQAINHYLSAMGKQEHASRWQSRPIPEDMQP
                        **************************************************

A0A8C5STS5_BCL2L11      EIWIAQELRRIGDEFNASYCPRRVTFNIFIVLNSFAYSSDGALSTYTKDR
A0A8C5STS5_BCL2L11      EIWIAQELRRIGDEFNASYCPRR-----------------GLLDYQGVNH
                        ***********************                 * *.    :.

A0A8C5STS5_BCL2L11      GKQMLHLEHLLNYW-----
A0A8C5STS5_BCL2L11      QIIILRLLHYIVRFIWRMQ
                           :*.* * :  :     

© 1998-2022Legal notice