Dataset for protein classical BH3-containing proteins of organism Lates calcarifer

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                     .        : 
--------------------------------------------------------p-q-dgsa-vftrsesgsvpsvdv
myrnkcclviicmnnvlnyiyptvvtytyktssltscystyqrllvytrvqppsrp-n-s--mtentaiedtegeaheeg
                 mvcficiclikvildnid  t rsghfcrandm flqnmkspdvt--a--mqqtekpdrwp r
                                                     l l a a  a  l idd  dd fel p

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          .                                                   .      .  *   .. :
eegesnqtsrsqeqrg----g----f--r----g-el------------------------qkrsifsyp--Rrsssgyf
aawamafsrtendgqitwtp-gers-gh-gstg-g--adspprcrtkaisgglpldslgvfpqpntvtlael lpvpari
sn rttereiktrrgcrqsl pnvplnrgrrrrrv ee w   lhrrrra   aapv     r lfygn gf  hf  h 
hc krg     c d       aala en mlpc a                                             

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 : .:. .                                                      .        .  .    .
sldgeslpssplsprpatadratqtpspt---------------------------------spnpsstqqrnapgdmqt
rfnsnqhartasrdeglqvrgeeeagt--sqvmkhflqrmteahgrgpgtqqlhgstpvlllegagfrgrsksqapalwa
e a   e  rqe e ------------                           vd       r  meqlpq v rsv
                                                                                

       250       260       270       280       290       300       310      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
    **:*. :.*:*                        : .:                      .          
eaviGQkLrrigDdFnrll-------g----vksqtttrqmhqsptwwscvgslllvigr----qggmnnqth---
akky  e qlms e dsehllrgvdk-hrrv-ipaqqlphirheksvllylfihqetefeiiylnnhhe-hd-rtv
  c          q h        ag empr -----vs rn gvl cvlacvcvsll drgfi-  --a--raqe
                                lqlyhrn h  c c  r  aa  c c      a  gg gr    
© 1998-2020Legal notice