Dataset for protein classical BH3-containing proteins of organism Lates calcarifer

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A4W6DUL1_BMF-01       --------------------------------------------------
A0A4W6EMZ7_BAD-01       --------------------------------------------------
A0A4W6EMZ7_BAD-02       MYRNKCCLVIICMNNVLNVCFPTVVLITVKLSNIDSCTSTYGHFLVYNRV
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      --------------------------------------------------
A0A4W6ETK4_BCL2L11      -----------------MYIYICICTYKYITDSLTSCYSRSQRLCRATDM
                                                                          

A0A4W6DUL1_BMF-01       -----------------MDDEEDDVFEPDPHCWRTTFREIKCEDRGTQTP
A0A4W6EMZ7_BAD-01       ------------MAANFTISDSESEASEEVEEGEMNQSSTEQEQQI----
A0A4W6EMZ7_BAD-02       QFLLNLPSPDVTMAANFTISDSESEASEEVEEGEMNQSSTEQEQQI----
A0A4W6ETK4_BCL2L11      -----MKAQADGAA-LFIQQTTKPVRWLDRSNGKRGERRRSTRRRCRWSL
A0A4W6ETK4_BCL2L11      ---QRPPNQSDGSTEVTAREESGGDPHVDGAAGASAQTSRSNDGGG----
A0A4W6ETK4_BCL2L11      QPPSRPPNQSDGSTEVTAREESGGDPHVDGAAGASAQTSRSNDGGG----
                                           .        :           .         

A0A4W6DUL1_BMF-01       GPALALNNGMLPCGVEEE-----------------------PRPLFYGNA
A0A4W6EMZ7_BAD-01       -----------------------------------------PQRNTVTLP
A0A4W6EMZ7_BAD-02       -----------------------------------------PQRNTVTLP
A0A4W6ETK4_BCL2L11      GANVPFERRRRRRRAEL--WPPRLHRRRRAGGLAAPVLGVFQKRSIFSYP
A0A4W6ETK4_BCL2L11      GGERSFGHRGSTGGGELADSPPRCRTKAIS---PLDSLGVFQKRSIFSYP
A0A4W6ETK4_BCL2L11      GGERSFGHRGSTGGGELADSPPRCRTKAIS---PLDSLGVFQKRSIFSYP
                                                                  .      .

A0A4W6DUL1_BMF-01       GFRLHFPAHFELAGNQEARRQESEE-------------------------
A0A4W6EMZ7_BAD-01       ELRLPVPGRIRLNSESHASTASRDEGLQVRGEEEAGTPT-----------
A0A4W6EMZ7_BAD-02       ELRLPVPGRIRLNSESHASTASRDEGLQVRGEEEAGTPT-----------
A0A4W6ETK4_BCL2L11      --RRSSSGYFSFDGESLPSSPLSPRPATADRATQTPSPTSQVMKHFLQRM
A0A4W6ETK4_BCL2L11      --RRSSSGYFSFDGESLPSSPLSPRPATADRATQTPSPTSQVMKHFLQRM
A0A4W6ETK4_BCL2L11      --RRSSSGYFSFDGESLPSSPLSPRPATADRATQTPSPTSQVMKHFLQRM
                          *   .. : : .:. .                                

A0A4W6DUL1_BMF-01       ----------------------ERNGMEQLPQRQPVARSVEACIGQKLQL
A0A4W6EMZ7_BAD-01       ----------------------EGAPFRGRSKSAPPALWAAKKYGQKLRR
A0A4W6EMZ7_BAD-02       ----------------------EGAPFRGRSKSAPPALWAAKKYGQKLRR
A0A4W6ETK4_BCL2L11      TEAHGRGPGTQQLHVDTPVLLLSPNPSSTQQRNAAGDMQTEAVIGQELRR
A0A4W6ETK4_BCL2L11      TEAHGRGPGTQQLHGS------SPNPSSTQQRNAAGDMQTEAVIGQELRR
A0A4W6ETK4_BCL2L11      TEAHGRGPGTQQLHGS------SPNPSSTQQRNAAGDMQTEAVIGQELRR
                                              .        .  .    .    **:*. 

A0A4W6DUL1_BMF-01       IGDQFHREH-------------LQLYHRNQRNQGPLWWRLAAALLSLLFD
A0A4W6EMZ7_BAD-01       MSDEFDSLL-----DKGEMRRVKSATTTRQMHHSKSWWSYLFSHQETEGE
A0A4W6EMZ7_BAD-02       MSDEFDSLL-----DKGEMRRVKSATTTRQMHHSKSWWSYLFSHQETEGE
A0A4W6ETK4_BCL2L11      IGDDFNRLLLLR---------------VSHHRHCVCVCVCVCVCVCVCGR
A0A4W6ETK4_BCL2L11      IGDDFNRLLLLRGVAGGHRPVVIPQQQLPHIHQEPTVLLCVGILLLVIGR
A0A4W6ETK4_BCL2L11      IGDDFNRLLLLRGVAGGHRPVVIPQQQLPHIHQEPTVLLCVGILLLVIGR
                        :.*:*                        : .:                 

A0A4W6DUL1_BMF-01       RGFIAGGGGAGRR---
A0A4W6EMZ7_BAD-01       ----NNHHENHTHRTE
A0A4W6EMZ7_BAD-02       ----NNHHENHTHRTE
A0A4W6ETK4_BCL2L11      -----GG---------
A0A4W6ETK4_BCL2L11      IIYLQGGMNNQDHAQV
A0A4W6ETK4_BCL2L11      IIYLQGGMNNQDHAQV
                             .          

© 1998-2020Legal notice