Dataset for protein Bad of organism Labrus bergylta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                               * . *****************************
---------------------------------------------stLtvsDVTMAAKFTISDSESGSEEEVKEEENDQS
mkcnnkcyhfirlvfvkkqsvicagygtvntfgpaysrdstenkimc gal                             

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
SAVEEPHVPQRHSLTLPELRLAGTGRIRLNSESHAYTVSRDEELQARGEEEAGTPTEGAPFRGRSKSAPPALWAAKKYGR
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****************   *  . *               * .* .:::                 *.**:      .. 
QLRRMSDEFDILLDKGvrkKvrspG---------------PksQmhntqsw---------------WsYLisiqtthssn
                emi gggg srggcglvvesvvsq ak efhskllqphvrcvlgslnvyk d  flhielegel

       250 
....:....|.
           
-----------
nhhenhthrne
© 1998-2020Legal notice