Dataset for protein Bad of organism Labrus bergylta

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q3FKT9_BAD-03      MKCNNKCYHFIRLVFVKKQSVICAGYGTVNTFGPAYSRDSTENKISCLGV
A0A3Q3FKT9_BAD-01      ---------------------------------------------MTLTA
                                                                      * .

A0A3Q3FKT9_BAD-03      LDVTMAAKFTISDSESGSEEEVKEEENDQSSAVEEPHVPQRHSLTLPELR
A0A3Q3FKT9_BAD-01      SDVTMAAKFTISDSESGSEEEVKEEENDQSSAVEEPHVPQRHSLTLPELR
                        *************************************************

A0A3Q3FKT9_BAD-03      LAGTGRIRLNSESHAYTVSRDEELQARGEEEAGTPTEGAPFRGRSKSAPP
A0A3Q3FKT9_BAD-01      LAGTGRIRLNSESHAYTVSRDEELQARGEEEAGTPTEGAPFRGRSKSAPP
                       **************************************************

A0A3Q3FKT9_BAD-03      ALWAAKKYGRQLRRMSDEFDILLDKGEMKKVRSPG---------------
A0A3Q3FKT9_BAD-01      ALWAAKKYGRQLRRMSDEFDILLDKGVRIKGGGGGSRGGCGLVVESVVSQ
                       **************************   *  . *               

A0A3Q3FKT9_BAD-03      PAKQMHHSKSW---------------WSYLFSHQETEGENNHHENHTHRN
A0A3Q3FKT9_BAD-01      PKSQEFNTQLLQPHVRCVLGSLNVYKWDYLILIITLHSSL----------
                       * .* .:::                 *.**:      ..           

A0A3Q3FKT9_BAD-03      E
A0A3Q3FKT9_BAD-01      -
                        

© 1998-2020Legal notice