Dataset for protein classical BH3-containing proteins of organism Homo sapiens

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------makqpsdvsse------cdregrqlqpae-------------------------rppqlr-pgaptslq
mkfgmgsaqac---e------mleddvfqpedqepvsqpgglardgprpfplgrlvpsavscsll-a-laaa--------
   mcpgplhrpcm-arqcve-fqipei-rsr--sstsvp         ggqlpgarrgpgprgcs-d---vqsllgcpl
      ckk  kgqv aaamttwvpcqle---lsd--a--                      grpghspfgpdapsdlgk
           grep gvqaarsavwp agqqep-rl-ya                      t ee ltsp l teahtp
            nga  s  cs  arl seppamrpeltq                      q  q grmk h g lgva
             a       a      g fn laaaenl                         t ve h   d  aqr
                              tl kktrr                           a a            
                              mi ahqpk                                          
                              d   eg                                            
                              a    e                                            
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
tepq----------------------------------------------------------------------------
----gnpecrprrphpaarclplrphrptrrhrrpggfplawgspqpaprpapgrssalalaggaapgvaraqrpggsgg
srlrlfdl                                                                        
hhrlcrag                                                                        
gpytpa t                                                                        
aawsdq                                                                          
rtqea                                                                           
 ma                                                                             
 g                                                                              
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------------------------------rs
rshpggpgsprgggtvgpgdrgnhggpglscphgspqgpltpsaspgpfgtrsplfifmrrssllsrsssgyfsfdtd--
                     thccaeadrptsqedkatqalppaspsqavvpirsrhssypagtlgptasrpvlaesml
                     appavt alwdashqgeqpssdshhrgatsqesvwsshntgnpsqqmqrplklavsqed
                     fql  l mtggrrwrdpmrrrargecmd ayglsrglegsedmqa ll  kdg slghc
                      ai  d g dsetvla etdg  la er psaeeqe adid ak  fd      qg lm
                       a       q ed    e f      l le  al   ca                 aa
                                                g  d                            
                                                e                               
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
papmscdkstqtpspp----------------as-----------e------lrr---------------d-f-------
----------------cqafplpnhylsampi--mrpaepadmrp-iwiaqe---igdlslcfgfiftgl-e-nayyarl
dcgvteepqrlfygnagyrlasaasfpavldpvaqpqegqwqhqaarqygrkyqdms           selqlvdlfvqg
tsslgvprgpfrgrhtedtkle kdcwvtdvdgraagprleellqyvrptaqpecsa             sdyhrshskr
se kpsrdaaseaa  pnv    gtlvcwgcasesvsvngvaawwvqeglkwiakvw             rsrpqqlea 
er  daalpggasl   g     pg  rs   qppselvvgsetrcppfwts vppt             qlighhslv 
gv  rr alvtlrq         l   p    tnwqacficrreewhnrqst saep              tattp kt 
 q  ll   he qp                  lvii tmerntysrdll ed p cl              n rsn tn 
    a    d   e                  dqge sls lssgq h  da l  c              a q k q  
                                 ied rhr ykkll                           m g p  
                                  vt naa widd                            l a g  
                                  fh     tg                                     
                                         f                                      
                                         c                                      

       330       340       350       360         
....:....|....:....|....:....|....:....|....:....
                                                 
-------------------------------------------------
lprpkglgrprlellqhqqrqsrvwwqillflhnlalnrgenrpgagpr
kektrsaptspragpptsmnpnpwrvlynrimglrprpgehranemern
isnlmrswpgkvpktnqrhtsdssktrvfqswwyivelvwsshlsr  p
  lihcfvladtqeeldksaevlpgmvlr ltrdqn g lrmn lq   
    f cr  tsfqsaavpfrrhralf   c lhpl s  lhl  k   
    a     qmvaqwypdvglcq s    a f  f e   c       
          nqtrnsscapf  l                         
          mps ikvawka  g                         
          lnr ghe vg                             
          gam  e  ie                             
            l     c                              
                                                 
                                                 
© 1998-2021Legal notice