Dataset for protein classical BH3-containing proteins of organism Homo sapiens

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------makqpsdvsse------cdregrqlqpae---------------------------------rppq---
mepsqcveelepdvfqpedgepwvpcqiv-qpeslpsaslglardgprpfplfaqspsdcplsrlqlfplthc-g-galg
 kfgmgsamfqd---------d      -t-a--g-grdp            agdgllgsgkhhrepglaaapcae-   
 pgmkprmqac-sqverseqt-      sss-fq-se--q            grlv gavscglcrrpaplpea-vt   
   kcacpgmripecveaamat      agprplsr-vva            m  l   rrgpgp      laqvss   
       kne vcppsavledr      trtyakaarqt-                                 hlln   
        ls grml g iamw       lmq drmpkpt                                 g gp   
         h a ga   clcs       fll akgaen                                    ad   
             a               e    hel l                                     c   
                                      e                                         
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------lrpgapt--------------slqtep------------q---------------
svlrplrarpgcrprrphpaarclpmlwtsqerrhrrpggfplawg--a--tlspaspsqgvve-gnphssypagtrqml
                         ataarsh              dk-qq-sashhgggtsrwprsrspnvgraslplg
                         -w-dqrl              qqepplppvtaalaaaysisgqlegsenpqaggd
                         s-ss-y-              aapmgdrdapgrms lspavwgaadidd k    
                         pvq-tly              cptga f  lecer  dllere  caa       
                          hhri-f              lggd         e  aaeapa            
                           gpewp               d a                l             
                           dldnk                                  d             
                            h gi                                                
                            e eg                                                
                               d                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------g------------------------------------------------------------------
aslrvlvgsegnh-gegdscphgygnagyrlplpasfspqgplappappgpwatrsplfifrrrssllsrsssgyfsfdt
sggpshp gmlpcrvteepqrlfsrpleeshlespvppavlaigeqpseaqfqhqgevqqgmklrriadqfmdsfvqaqy
         rddpsmgrprsvqrglspasqwstakrcvvadvpsrsqtqnlpgveayeeswaeeqcmsrerhrlhlklfl
         pssellpatlgtfpaah vrvkgs tltwrpqhvlgavvcfartayrwq  ahstigeqltmvaddtnslk
         dmrqiksqldphtlwsl sndg r qgnlqsaettagtaapelrrlqt   teqygqatqsppqerrtyye
         aaga  r  vldserqa  a     l l  r  evqvh tksgvlkeq   h giadv egiqlpiqdkka
           fv  m  afardkp           a     arlm  r rasi d      d pls  dcg n na   
           a   l   a p  k                  e    l   fc          eap    e a gg   
               a     g  e                                         k        d    
                                                                           a    
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--spapmscdkstqtpsppcqaf---n--l--m-----------------------------------------------
dr---------------------wqi-hy-sa-alasmrqaepadmrpeiwiaqelrrigdlslcfgfiftgldefnayy
egrrrerppgqgrhrqqnqsrvwtrvllfwhnlndngeenrrgpgpeenqnplkwvekssevvv          lyghhh
rnlgltkdksaqgahrmrwrvlylsafqimglrlhvrgsslnaverpgvr l    ad e                    
nlktqwvcvrtallvslsanstlallgdsfwtpdasnpighvvrlhl r        e                      
kicskvlwaer sgskifspdsr   ptq cd c plwdeepsqwl                                  
gamqsshtstp qwqacelvwrt     a pw   gaivh lik                                    
  iefrf rnd  sm aaf pgg       le   cvqla  l                                     
  h  l   ms  r      lca       e     if                                          
  a      le         g                                                           
                    c                                                           
                                                                                

       330       340       350     
....:....|....:....|....:....|....:
                                   
-----------------------------------
arrlellndsstsdhprmvilrllryivrlvwrmh
sqdmpkppyqdfe                      
   vfqnlhkaa                       
   ta   a                          
                                   
                                   
                                   
                                   
                                   
                                   
                                   
© 1998-2021Legal notice