Dataset for protein classical BH3-containing proteins of organism Homo sapiens

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------makqpsdvsse------cdregrq---------------------------------------------
mkfgmgsaqac---e------mwvpcqi--lqdpvgprtpggqlpgarrgpgprrpaplparppgalgsvlrplrarpgc
   mcpgplhrpcm-arqcve-leddvlapfrids                                             
      ckk  kgqv aaamtt aawlfqr----e                                             
           grep gvqaar      ggqpvs-                                             
            nga  s  cs       epnlmr                                             
             a       a        tlelp                                             
                              sdaka                                             
                              m  ek                                             
                              e  ah                                             
                              a                                                 
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------lqpae-------------------------rppqlr-pgaptslq
rprrphpaarclplrphrptrrhrrpggfplawgsf----gepvtqpgsllsadlfaqslldcpl------p-thccgpg
                                   -eredqldrdg rpfplgr vpsavscglcsrlpafalsssaer-
                                   pslsqlma                   t eqhglsavra---a-w
                                   arkvp  e                      eaargpsv-lvp-qt
                                   saapl                         t ve k slellntr
                                      ni                         g s  h q teglmp
                                      da                                h qayhgl
                                                                        e g edaa
                                                                          d  c  
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
tepq----------------------------------------------------------------------------
lr-tgnpdgnhggegdscphgspqgplaggtvgpgdrgpaaadggrpqrtvraaetrppaspgpfatrsplfifmrrssl
agyssqeekatqtlsalggsrw gs rs                             rargar dtleg vqshhgtpam
-aqrpagtapsasgkgrshp g     g                             g  a p l               
q-wlcprgqrplvta                                                                 
gtr-vmaaf q  s                                                                  
smiwt     i                                                                     
pldpd                                                                           
  ag                                                                            
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------drspapmscdkstqtpsppcqafnh----l--m-----a-p--a-p------------ia--l----
lsrsssgyfsfdt----------------e--------agyy-sa-asfpa-s-rq-e-admrwpeiwevq--qe-rrig
tqgptrprkllssparqsqgvmlpcgvqe-qqrlfyhngearaplprdrvsvlmigeqdpegqgehqaarrlgrksacma
ql fq  kdgaqlhhqtrlvllwdashsqvwstsssgsdsdgwveikwshgsylaltavgvrmeqrpspfegrssvqpps
             gpcsgnsdvrrhlerrldvaptlap  lftctsdrcavgvvpepssdcvgsrlkqrlaylarddlyn
             vspe  lgaeqmrgphg lpggrla   lstwlvaaqterwtpwvqvmlsllfgfdgmfftq lslp
             sn    hagpgghch a addvavw   ecmqgs qrqpneliqlirgfencsep a q kg  mh 
              l         d se      mest     a en plelgadsidhe iv hnn    k el  gc 
                          d         pf        i ei  dsvc wls e    a      da  d  
                                    dc        c     ifea pel d                  
                                                    a    g k                    
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
defnayyarrlqlnqnrvwwqilrflhnlalngeprprgagpptqmrqssswtrvfqswwprnlgrgssapsqsgggltq
lqlaqlheqqhpkrpssgtfvdwlvvykrgmgllenrnsrrtremepnvpryllllrayrdptysqrlhvllsle     
hwahrslvkleeqprqqhrpspsfmtlrkivryivllkwhmaavswgshllrggaalkrllqlsakhgamaap       
vdhvdrfgngrheenmcdeglhpwtsilwltmtqwtsvtpprwkgler  epf     lf  a  g   l  k       
ahvstqtl tmfrlkdasaedrqksfssstrfrffhepn cht ac    aa                            
 srrsdek nvaadfypasatqm q   eniaha e el  v                                      
 p lfk d  ntitlvlrp mlg      c           s                                      
 n g i    ks shckm  ag                   n                                      
 l   e    id  da l                                                              
 g             t                                                                
               l                                                                

      
....:.
      
------
ipfrcv
      
      
      
      
      
      
      
      
      
      
© 1998-2022Legal notice