Dataset for protein classical BH3-containing proteins of organism Homo sapiens

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------makqpsdvsse------cdregrqlqpae---------------------------------rppq---
mepsqcveeleddvfqpedgepwvpcqivtqpeslasadlglardgprpfplfaqspsdcplsrlqlfplthc-g-galg
 kfgmgsamfq--e---s-q-d      sssap-g-g-sp            agdgllgsgkhhrepglaaapcar-   
   mppkpqacip-per-e-t-      -----n-wer-r            grlv gavscglcrrpaplpey-vt   
    c cklsmpcqvsgaamrt      agprmqssalv-            m  l   rrgpgp      lafvss   
        arrgrpl afraas      rray lap-kqq                                 alqe   
         hkvema  vilpr      tltv krtr pt                                 q lp   
           n g    c ma      eemq ckgp td                                 h ek   
                    c         ll ah l ra                                 g d    
                              e       n                                         
                                      e                                         
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------lrpgaptslqtep------------q-----------------------------
svlrplrarpgcrprrphpaarclpmlwtsqedkaqqtpavtaalggsrw-gnpspgrssalalaggaapgvaraqrpgg
                         --ad-shaqesplllgrrnw spqppvgle                         
                         st-ar-vqaparkggfpl       asssr                         
                         pvrstylfvlrgd             rrrd                         
                         ahh-qddcrtmaw             ppqa                         
                          edmiw-rpdlfr              df                          
                            pelplghkl                                           
                            h gneeggd                                           
                            e ek d e                                            
                              ci   d                                            
                               g                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------g--------------------------------g------------------------------
sggrshpggpgnhgge-dscphgrhslapagtespvaspqgplappasp-pfatrsplfifmrrssllsrsssgyfsfdt
          saspsqtvvgirsslasyeshltqtlpvapvavrgmlpcavteepqrfeygnaeyraplpamfpavlpig
          phprmarsdetqpwspnssqwsspqstlrvqltlseddqsmpgvygeerqwhqgigpqetrqaddlnaql
           rqlepqayslswkkldvrdpkrgmrn qrahegqgqtepagvplpvqqgraptpvktqgkgcvvagvpy
           sei g prphprggecignlglald  la e elvpvaksrtleltvlsapg nl a apelwrsdlls
           lac r tlfegle  a d a a            amgv llrcaadt aqr  ea    l   iqt av
           f   m l a ed     a                  a  ks    as  p              d    
                     a                                      h                   
                                                            e                   
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
drspapmscdkst--psppcq--n---sam--------------------------------------------------
----------q--qt------af-hyl---asmrqaepagldmrpeiwiaqelrrigvwwqillflhnladefnayyarr
eqptrgqwqh-aevrigrklrciadqfhrlvvqigevavemprpksagtqhqqnqsssltrvfqswwtrllnggenrnga
rsrrenlrartqyhqraswrvtyslimvdsftkdehrvrralpnevq pltwmeknrdrslc gaifdgn lyeshhssq
palsqekdrgrrrrmklfepdrmysegglahrpaksslpisehsrns swksiadvprgl l    llpg gr hsapqd
kpa pfvcvaeglga tesywltlwawpfrpleva nikwfwl  tp qhvacpfrlla         i  s  l lllk
alq lwrtsedegl  q lslplfrs dqpdnwn  l m  vg  ll g s   a cg                      
qgc ctegttydw     gi dv  p megcdsl       r    e                                 
nnv tshafmp q     da  r    lc yaie                                              
hmt mlf  il                e  lit                                               
g i ka                        ghf                                               
  h                            gc                                               
  f                             a                                               

       330       340       350  
....:....|....:....|....:....|..
                                
--------------------------------
gpklndsstsdhprmvilrllryivrlvwrmh
lerppyqdfe                      
mrlnlhkaa                       
vfq  a                          
tap                             
                                
                                
                                
                                
                                
                                
                                
© 1998-2020Legal notice