Dataset for protein classical BH3-containing proteins of organism Homo sapiens

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------makqPsdvsse------cdregrq---------------------------------------------
mkfgmgsaqac--me-rqcvetwvpcqi--l-ddvgprtpggqlpgarrgpgprrpaplparppgalgsvlrplrarpgc
  mpgkkmrqnpcqv -aamtrlevevsar-r-ss                                             
        fkmrq-- a---a-iwidcfsgqqa--                                             
          iaeps gsqr-s  d   qpppetp                                             
             fa  rmpp        eed qk                                             
             a   e ed        at  ph                                             
                              m  lg                                             
                                 ke                                             
                                 ea                                             
                                 a                                              
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------lqpae-------------------------rppqlr-pgaptslq
rprrphpaarclplrphrptrrhrrpggfplawgsf--edglardgprpfplgrlvpsavscglcge-vtqahasllaad
                                   pel--tgpsgsgkhhrqapgllwda hqqe--g-sar--ga-n--
                                   -skvpd e                      qhvpa-vssd-glvp
                                   ardpl                         e tl-tsi -kf-ta
                                    a ng                           ssvsqf teaggy
                                      da                           legph  l    t
                                                                   a  h        g
                                                                               e
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
tepq----------------------------------------------------------------------------
lfargnpegnhggegdscphgspqgplaggtvgpgdrgpaaadggrpqrtvraaetrppaspgpfltrsplfifmrrssl
-aylcartappavtaalggsrw gs rs                             rargar saldcsvsrlqlfplt
ag--vqagqaql s grshp g     g                             g  a p dgpqp  qshhgt km
g-stsp dfri  a                                                  rteng       i a 
qyrgd  a                                                        l  k            
it                                                              k  e            
 r                                                                              
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------drspapmscdkstqtpsppcqa-------l-am--asmr---pa-------i---lrr---------
lsrsssgyfsfdt----------------------feepnhy-s--dd----qae--dmrpeiw-aqe---igwqhqaev
hccgpglrptsqeqkatqtlppaspsggvmltpgvtasaqrlfygn  vgyplprgesfpavlppgeqppegqdrslqfg
tqsptrpkkllasshlss vdvrdgglrgle sdtl   gdf ctp  qaasgvlvveevwareylawqskms lrec  
qlgfq   dgaslglcer agsppdaeaqg   pf             srwissvikllqvsqrtttanedsa       
f             a  y  ater h m e                  gnieelmwcyhwe dlrqpt acfe       
                     l   e e                    rvgdrehssnctr w   ks  qvt       
                                                deechng passq     r   ppc       
                                                 qvaa a g k           ae        
                                                 is                             
                                                  r                             
                                                  p                             
                                                  l                             
                                                  f                             

       330       340       350       360       370    
....:....|....:....|....:....|....:....|....:....|....
                                                      
------------------------------------------------------
qiarkldefnayyarrlvqppqqnqnrvwrqillflhnlalngeenrngagprn
f ftgeqdiadqfhqlhellhdshrpsppwvlynrimgylplprghmapemep 
    s sclghhlskgvpkqnarstsdhqkmvirlclrhivrlvwrch r r  
       lyvtsheadrqeeqykpfetqm ssp   tf qfee l         
       scq lsp qmfanlhvdagll   f    r                 
       a p g l ntarsktpava                            
             k mpt iescvk                             
                ar   eamg                             
                 l     g                              
                                                      
                                                      
                                                      
                                                      
© 1998-2022Legal notice