Dataset for protein classical BH3-containing proteins of organism Homo sapiens

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------makqpsdvsse------cdregrq---------------------------------------------
mkfgmgsaqac---e------mwvpcqi--lqdpvgprtpggqlpgarrgpgprrpaplparppgalgsvlrplrarpgc
   mcpgplhrpcm-arqcve-leddvfapfrids                                             
      ckk  kgqv aaamtt      qg----e                                             
           grep gvqaar       rqpvs-                                             
            nga  s  cs       eplemr                                             
             a       a        tdalp                                             
                              s  ka                                             
                              m  ek                                             
                              e  ah                                             
                              a                                                 
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------lqpae-------------------------rppqlr-pgaptslqtepq------------------
rprrphpaarclpfe-edglardgprpfplgrlvpsavscglcge----a------a-----gnpegnhggegdscphgs
             --a--                      t lq-dvtqvraslll-dlfarslldcplsrlqlfplthc
             psrsl                        e-trraarvsgvpntwaaylcartaapavtaalggssw
             arlvr                         lmglsp qtefgaqtggqwpqarp ql ss  a arl
             sakdq                         ehvpnl llteahmrqtwtdp gf i         lg
               dwi                         tgsehk h q eg pssr                   
                pa                         pal  h e d  d apmi                   
                n                            e         c l ld                   
                h                            a                                  
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
pqgglappaspdpfatrshpggpgsprgggtvgpgdrgpaaadggrpqrtvraaetrgaaaappltlegplfifmrrssl
cgpprrrtsqegkatqtl                                                   svqshhgtpam
aerlvg spagrgpsgsg                                                   k          
yaq  s arg   dg                                                                 
     e  tr   s                                                                  
        qm                                                                      
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------drspapmscdkstqtpsppcqafnh----l--m-----a-p--a-p------------ia--l----
lsrsssgyfsfdt----------------e--------agyy-sa-asfpa-s-rq-e-admrwpeiwevq--qe-rrig
tqgptrprkllssparqsqgvmlpcgvqe-qqrlfyhngearaplprdrvsvlmigeqdpegqgehqaarrlgrksacma
ql fq  kdgaqlhhqtrlvllwdashsqvwstsssgsdsdgwveikwshgsylaltavgvrmeqrpspfegrssvqpps
             gpcsgnsdvrrhlerrldvaptlap  lftctsdrcavgvvpepssdcvgsrlkqrlaylarddlyn
             vspe  lgaeqmrgphg lpggrla   lstwlvaaqterwtpwvqvmlsllfgfdgmfftq lslp
             sn    hagpgghch a addvavw   ecmqgs qrqpneliqlirgfencsep a q kg  mh 
              l         d se      mest     a en plelgadsidhe iv hnn    k el  gc 
                          d         pf        i ei  dsvc wls e    a      da  d  
                                    dc        c     ifea pel d                  
                                                    a    g k                    
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
defnayyarrlqlnqnrvwwqilrflhnlalngeprprgagpptqmrqssswtrvfqswwprnlgrgssapsqsgggltq
lqlaqlheqqhpkrpssgtfvdwlvvykrgmgllenrnsrrtremepnvpryllllrayrdptysqrlhvllsle     
hwahrslvkleeqprqqhrpspsfmtlrkivryivllkwhmaavswgshllrggaalkrllqlsakhgamaap       
vdhvdrfgngrheenmcdeglhpwtsilwltmtqwtsvtpprwkgler  epf     lf  a  g   l  k       
ahvstqtl tmfrlkdasaedrqksfssstrfrffhepn cht ac    aa                            
 srrsdek nvaadfypasatqm q   eniaha e el  v                                      
 p lfk d  ntitlvlrp mlg      c           s                                      
 n g i    ks shckm  ag                   n                                      
 l   e    id  da l                                                              
 g             t                                                                
               l                                                                

      
....:.
      
------
ipfrcv
      
      
      
      
      
      
      
      
      
      
© 1998-2021Legal notice