Dataset for protein classical BH3-containing proteins of organism Homo sapiens

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------makqpsdvssecdregrqLqpae---------------------------------rppqlrpgaptslqtep
mcpcmfqipefepseqedsssaepg-gaspglardgprpfplgrlvpsavagdgpsgsgkhhrqa-g-lwdrshqqeqpt
    psh------------r--p-npe--q                    seglcepglaaap--a-v-ya-elrrmsde
     levgresrpfrgrt-qy-s-awlv-                    mc           a  t va-m----gd--
       rrpl gaimm allsmqs - rt                                 s    t-l ywle--rn
         mg   ala  ac agr   ps                                      al  tkcaprll
          a             l    d                                          lda   ad
                                                                        a       
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------q-------------------------------------------------------------------
pavtaalggsrw-gnpegnhggegdscphgsypagteddegmgespqgplappaspgpfatrsplfifmrdrssllsrss
l           ssshhsgaraveirsrrswsslvwssltsvspeaspfrgrsrvapmnlwaaqrygrte lrrmsdefv
            pvgdrdspecprplghqtlrlpsrqwemetvnrqpraallqqtqslsvvvgseeqqgk iipvqltrm
             me f rl  m gddapp la cighpddr lnnvqlvqggpp mhpgpl fsldwah eenapvsal
                  e         la    ae    ap h  adgmkaeld ka  l  ei a    a g kr  a
                                               a     e  a   g  d         d      
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------drspapmscdkstqtpsppcqafnhylsam--asm-------------------------------------
sgyfsfdt------------------------------wd---rqaepadmrpeiwiaqelrrigdlslcfgfiftglde
dsftfvksglrtlwrpksagravqmrqssswtrvfqswdpvnlssgssvlsqevqgplkwvekssevvv          l
glwltlrkfkkrqetrrtrrvwrswgwvllyllpwlllrlpvwgrlrvlphssng lt ipadcv               
add naqynvmgm h pnpqstkglesrprtywlmrkylasaiighvipelprgl      fe e               
       ehqa f   egqp raac rhvprggiagcrf rrgdeelamagkl                           
        ei       e   p  a ga epf a   aa qlealrgw  ae                            
                 a   h        a         gtyek ah                                
                                         is                                     
                                          p                                     
                                          f                                     
                                          a                                     

       250       260       270       280
....:....|....:....|....:....|....:....|
                                        
----------------------------------------
fnayyarrleklndsstsdhprmvilrllryivrlvwrmh
yghhhsqdmplppyqdfe                      
        vfqnlhkaa                       
        ta   a                          
                                        
                                        
                                        
                                        
                                        
                                        
                                        
© 1998-2023Legal notice