Dataset for protein classical BH3-containing proteins of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

50 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


O00198_HRK-03          ---------------AAAQVAALAAWLLGRRNL-----------------
Q96LC9_BMF-09          -------------MEPSQCVEELEDD------------------------
Q9BXH1_BBC3-03         MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRG
Q96LC9_BMF-05          -------------MEPSQCVEE--------LEDDV---------------
Q96LC9_BMF-07          -------------MEPSQCVEE--------LEDDV---------------
Q96LC9_BMF-06          -------------MEPSQCVEE--------LEDDV---------------
Q96LC9_BMF-01          -------------MEPSQCVEE--------LEDDV---------------
Q96LC9_BMF-02          -------------MEPSQCVEE--------LEDDV---------------
Q96LC9_BMF-03          -------------MEPSQCVEE--------LEDDV---------------
Q96LC9_BMF-04          -------------MEPSQCVEE--------LEDDV---------------
Q13323_BIK-01          ---------------------M--------SEVRP---------------
Q92934_BAD-03          ---------------------M--------FQIPE---------------
Q92934_BAD-04          ---------------------M--------FQIPE---------------
B4DZQ9_BAD-01          ---------------------M--------FQIPE---------------
Q92934_BAD-01          ---------------------M--------FQIPE---------------
Q92934_BAD-02          ---------------------M--------FQIPE---------------
Q9BXH1_BBC3-05         MKFGMGSAQACPCQVPRAASTTWVPCQICGPQ-PS---------------
Q9BXH1_BBC3-04         MKFGMGSAQACPCQVPRAASTTWVPCQICETRGAA---------------
O00198_HRK-01          ---MCPCPLHRGRGPPAVCACS------AGRLGLR---------------
B4DQK3_BBC3-01         -------------MAPGSAMAR------ARQEGSS---------------
Q9BXH1_BBC3-06         -------------------MAR------ARQEGSS---------------
Q13794_PMAIP1-02       ------------------------------MPGKK---------------
O43521_BCL2L11-04      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-05      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-10      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-11      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-19      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-01      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-06      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-18      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-08      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-21      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-12      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-20      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-07      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-22      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-02      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-15      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-09      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-14      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-17      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-03      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-23      -------------KQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-13      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-16      -----------MAKQPSDVSSE------CDREGRQ---------------
Q6JTU4_BCL2L11-01      ---------------------------------MR---------------
Q13794_PMAIP1-01       ----MPGKKARKNAQPS------------PARAPA---------------
Q96LC9_BMF-08          -------------MEPSQCVEELEDDVFQPEDGEP---------------
Q92934_BAD-06          -----------MGEEPS------------PFRGRS---------------
Q92934_BAD-05          -----------MGEEPS------------PFRGRS---------------
                                                                         

O00198_HRK-03          --------------------------------------------------
Q96LC9_BMF-09          --------------------------------------------------
Q9BXH1_BBC3-03         PGPRRPAPLPARPPGALGSVLRPLRARPGCRPRRPHPAARCLPLRPHRPT
Q96LC9_BMF-05          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
Q96LC9_BMF-06          --------------------------------------------------
Q96LC9_BMF-01          --------------------------------------------------
Q96LC9_BMF-02          --------------------------------------------------
Q96LC9_BMF-03          --------------------------------------------------
Q96LC9_BMF-04          --------------------------------------------------
Q13323_BIK-01          --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
Q9BXH1_BBC3-05         --------------------------------------------------
Q9BXH1_BBC3-04         --------------------------------------------------
O00198_HRK-01          --------------------------------------------------
B4DQK3_BBC3-01         --------------------------------------------------
Q9BXH1_BBC3-06         --------------------------------------------------
Q13794_PMAIP1-02       --------------------------------------------------
O43521_BCL2L11-04      --------------------------------------------------
O43521_BCL2L11-05      --------------------------------------------------
O43521_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-11      --------------------------------------------------
O43521_BCL2L11-19      --------------------------------------------------
O43521_BCL2L11-01      --------------------------------------------------
O43521_BCL2L11-06      --------------------------------------------------
O43521_BCL2L11-18      --------------------------------------------------
O43521_BCL2L11-08      --------------------------------------------------
O43521_BCL2L11-21      --------------------------------------------------
O43521_BCL2L11-12      --------------------------------------------------
O43521_BCL2L11-20      --------------------------------------------------
O43521_BCL2L11-07      --------------------------------------------------
O43521_BCL2L11-22      --------------------------------------------------
O43521_BCL2L11-02      --------------------------------------------------
O43521_BCL2L11-15      --------------------------------------------------
O43521_BCL2L11-09      --------------------------------------------------
O43521_BCL2L11-14      --------------------------------------------------
O43521_BCL2L11-17      --------------------------------------------------
O43521_BCL2L11-03      --------------------------------------------------
O43521_BCL2L11-23      --------------------------------------------------
O43521_BCL2L11-13      --------------------------------------------------
O43521_BCL2L11-16      --------------------------------------------------
Q6JTU4_BCL2L11-01      --------------------------------------------------
Q13794_PMAIP1-01       --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
                                                                         

O00198_HRK-03          --------------------------------------------------
Q96LC9_BMF-09          --------------------------------------------------
Q9BXH1_BBC3-03         RRHRRPGGFPLAWGSPQPAP-------------------------RPAPG
Q96LC9_BMF-05          ---------------FQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQL
Q96LC9_BMF-07          ---------------FQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQL
Q96LC9_BMF-06          ---------------FQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQL
Q96LC9_BMF-01          ---------------FQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQL
Q96LC9_BMF-02          ---------------FQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQL
Q96LC9_BMF-03          ---------------FQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQL
Q96LC9_BMF-04          ---------------FQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQL
Q13323_BIK-01          ---------------LSRDILME---------------------------
Q92934_BAD-03          ---------------FEPSEQED---------------------------
Q92934_BAD-04          ---------------FEPSEQED---------------------------
B4DZQ9_BAD-01          ---------------FEPSEQED---------------------------
Q92934_BAD-01          ---------------FEPSEQED---------------------------
Q92934_BAD-02          ---------------FEPSEQED---------------------------
Q9BXH1_BBC3-05         ---------------LSLAE-------------------------QHLES
Q9BXH1_BBC3-04         ---------------AAPPL----------------------TLEGPVQS
O00198_HRK-01          ---------------SSAAQ------------------------LTAARL
B4DQK3_BBC3-01         ---------------PEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLA
Q9BXH1_BBC3-06         ---------------PEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLA
Q13794_PMAIP1-02       ---------------ARKNA-------------------------QPSPA
O43521_BCL2L11-04      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-05      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-10      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-11      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-19      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-01      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-06      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-18      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-08      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-21      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-12      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-20      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-07      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-22      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-02      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-15      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-09      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-14      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-17      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-03      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-23      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-13      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-16      ---------------LQPAE-------------------------RPPQL
Q6JTU4_BCL2L11-01      --------------------------------------------------
Q13794_PMAIP1-01       --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
                                                                         

O00198_HRK-03          --------------------------------------------------
Q96LC9_BMF-09          --------------------------------------------------
Q9BXH1_BBC3-03         RSSALALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPA
Q96LC9_BMF-05          FPLTHCCGPGLRPTSQEDKATQTLS-------------------------
Q96LC9_BMF-07          FPLTHCCGPGLRPTSQEDKATQTLS-------------------------
Q96LC9_BMF-06          FPLTHCCGPGLRPTSQEDKATQTLS-------------------------
Q96LC9_BMF-01          FPLTHCCGPGLRPTSQEDKATQTLS-------------------------
Q96LC9_BMF-02          FPLTHCCGPGLRPTSQEDKATQTLS-------------------------
Q96LC9_BMF-03          FPLTHCCGPGLRPTSQEDKATQTLS-------------------------
Q96LC9_BMF-04          FPLTHCCGPGLRPTSQEDKATQTLS-------------------------
Q13323_BIK-01          ---TLLYEQLLEPPTME---------------------------------
Q92934_BAD-03          ---SSSAERGLGPSPAGDGPSGSGK-------------------------
Q92934_BAD-04          ---SSSAERGLGPSPAGDGPSGSGK-------------------------
B4DZQ9_BAD-01          ---SSSAERGLGPSPAGDGPSGSGK-------------------------
Q92934_BAD-01          ---SSSAERGLGPSPAGDGPSGSGK-------------------------
Q92934_BAD-02          ---SSSAERGLGPSPAGDGPSGSGK-------------------------
Q9BXH1_BBC3-05         PVPSAPGALAGGPT------------------------------------
Q9BXH1_BBC3-04         H-HGTP-ALTQGPQSPRDGAQL----------------------------
O00198_HRK-01          KALGDELHQRTMWR------------------------------------
B4DQK3_BBC3-01         AAPAAPTLLPAAYLCAPTAPPAVTAALGGSRWPGGPRS------------
Q9BXH1_BBC3-06         AAPAAPTLLPAAYLCAPTAPPAVTAALGGSRWPGGPRS------------
Q13794_PMAIP1-02       RAPAGPAGTAGTARDQAGFAIG----------------------------
O43521_BCL2L11-04      R-PGAPTSLQTEPQ------------------------------------
O43521_BCL2L11-05      R-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA------------
O43521_BCL2L11-10      R-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA------------
O43521_BCL2L11-11      R-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA------------
O43521_BCL2L11-19      R-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA------------
O43521_BCL2L11-01      R-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA------------
O43521_BCL2L11-06      R-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA------------
O43521_BCL2L11-18      R-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA------------
O43521_BCL2L11-08      R-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA------------
O43521_BCL2L11-21      R-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA------------
O43521_BCL2L11-12      R-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA------------
O43521_BCL2L11-20      R-PGAPTSLQTEPQ------------------------------------
O43521_BCL2L11-07      R-PGAPTSLQTEPQ------------------------------------
O43521_BCL2L11-22      R-PGAPTSLQTEPQ------------------------------------
O43521_BCL2L11-02      R-PGAPTSLQTEPQ------------------------------------
O43521_BCL2L11-15      R-PGAPTSLQTEPQ------------------------------------
O43521_BCL2L11-09      R-PGAPTSLQTEPQ------------------------------------
O43521_BCL2L11-14      R-PGAPTSLQTEPQ------------------------------------
O43521_BCL2L11-17      R-PGAPTSLQTEPQ------------------------------------
O43521_BCL2L11-03      R-PGAPTSLQTEPQ------------------------------------
O43521_BCL2L11-23      R-PGAPTSLQTEPQ------------------------------------
O43521_BCL2L11-13      R-PGAPTSLQTEPQ------------------------------------
O43521_BCL2L11-16      R-PGAPTSLQTEPQ------------------------------------
Q6JTU4_BCL2L11-01      --QAEPADMRPEIW------------------------------------
Q13794_PMAIP1-01       --ELEVECATQLRR------------------------------------
Q96LC9_BMF-08          --VTQPGSLLSADL------------------------------------
Q92934_BAD-06          --RSAPPNLWAAQR------------------------------------
Q92934_BAD-05          --RSAPPNLWAAQR------------------------------------
                                                                         

O00198_HRK-03          --------------------------------------------------
Q96LC9_BMF-09          --------------------------------------------------
Q9BXH1_BBC3-03         AADGGRPQRTVRAAETRGAAAAPPLTLEGPVQSHHGTPALTQGPQSPRDG
Q96LC9_BMF-05          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
Q96LC9_BMF-06          --------------------------------------------------
Q96LC9_BMF-01          --------------------------------------------------
Q96LC9_BMF-02          --------------------------------------------------
Q96LC9_BMF-03          --------------------------------------------------
Q96LC9_BMF-04          --------------------------------------------------
Q13323_BIK-01          --------------------------------------------------
Q92934_BAD-03          --------------------------------------------------
Q92934_BAD-04          --------------------------------------------------
B4DZQ9_BAD-01          --------------------------------------------------
Q92934_BAD-01          --------------------------------------------------
Q92934_BAD-02          --------------------------------------------------
Q9BXH1_BBC3-05         --------------------------------------------------
Q9BXH1_BBC3-04         --------------------------------------------------
O00198_HRK-01          --------------------------------------------------
B4DQK3_BBC3-01         -----------------RPRGPRPD-------------------------
Q9BXH1_BBC3-06         -----------------RPRGPRPD-------------------------
Q13794_PMAIP1-02       ---------------------------------------MQLRFTRGKKL
O43521_BCL2L11-04      --------------------------------------------------
O43521_BCL2L11-05      -----------------PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS
O43521_BCL2L11-10      -----------------PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS
O43521_BCL2L11-11      -----------------PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS
O43521_BCL2L11-19      -----------------PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS
O43521_BCL2L11-01      -----------------PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS
O43521_BCL2L11-06      -----------------PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS
O43521_BCL2L11-18      -----------------PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS
O43521_BCL2L11-08      -----------------PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS
O43521_BCL2L11-21      -----------------PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS
O43521_BCL2L11-12      -----------------PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS
O43521_BCL2L11-20      --------------------------------------------------
O43521_BCL2L11-07      --------------------------------------------------
O43521_BCL2L11-22      --------------------------------------------------
O43521_BCL2L11-02      --------------------------------------------------
O43521_BCL2L11-15      --------------------------------------------------
O43521_BCL2L11-09      --------------------------------------------------
O43521_BCL2L11-14      --------------------------------------------------
O43521_BCL2L11-17      --------------------------------------------------
O43521_BCL2L11-03      --------------------------------------------------
O43521_BCL2L11-23      --------------------------------------------------
O43521_BCL2L11-13      --------------------------------------------------
O43521_BCL2L11-16      --------------------------------------------------
Q6JTU4_BCL2L11-01      --------------------------------------------------
Q13794_PMAIP1-01       --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
                                                                         

O00198_HRK-03          --------------------------------------------------
Q96LC9_BMF-09          --------------------------------------------------
Q9BXH1_BBC3-03         AQLGACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM--------------
Q96LC9_BMF-05          ---PASPSQGVMLPCGVTEEPQRLFYAPAE-----PKSCVVADPPLPAQP
Q96LC9_BMF-07          ---PASPSQGVMLPCGVTEEPQRLFYAPAE-----PKSCVVADPPLPAQP
Q96LC9_BMF-06          ---PASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPP
Q96LC9_BMF-01          ---PASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPP
Q96LC9_BMF-02          ---PASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPP
Q96LC9_BMF-03          ---PASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPP
Q96LC9_BMF-04          ---PASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPP
Q13323_BIK-01          -----------VLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDE
Q92934_BAD-03          ---HHRQAPGLLWDASHQQEQPTSSSHHGE---------------GTSSP
Q92934_BAD-04          ---HHRQAPGLLWDASHQQEQPTSSSHHGG---------RTSYSPSWESE
B4DZQ9_BAD-01          ---HHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDD
Q92934_BAD-01          ---HHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDD
Q92934_BAD-02          ---HHRQAPGLLWDASHQQEQPTSSSHHGGAGAVEIRSRHSSYPAGTEDD
Q9BXH1_BBC3-05         ---------------------------------------------QAAPG
Q9BXH1_BBC3-04         ---GACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM--------------
O00198_HRK-01          ------------RRARSRRAPAPGALPT---YWPWLCAAAQVAALAAWLL
B4DQK3_BBC3-01         ---GPQPSLSLAEQHLESPVPSAPGALA-------------GGPTQAAPG
Q9BXH1_BBC3-06         ---GPQPSLSLAEQHLESPVPSAPGALA-------------GGPTQAAPG
Q13794_PMAIP1-02       LSSSLSSSPLALPRGHEEQVQVAGSRVC---YSTQEIWRQTELPAETSES
O43521_BCL2L11-04      ---DRSPAPMSCDKSTQTPSPPCQAFNH---YLSAM-----ASMRQAEPA
O43521_BCL2L11-05      FDTDRSPAPMSCDKSTQTPSPPCQAFNH---YLSAM-----ASMRQAEPA
O43521_BCL2L11-10      FDTDRSPAPMSCDKSTQTPSPPCQAFNH---YLSAM-----ASMRQAEPA
O43521_BCL2L11-11      FDTDRSPAPMSCDKSTQTPSPPCQAFNH---YLSAM-----ASMRQAEPA
O43521_BCL2L11-19      FDTDRSPAPMSCDKSTQTPSPPCQAFNH---YLSAM-----ASMRQAEPA
O43521_BCL2L11-01      FDTDRSPAPMSCDKSTQTPSPPCQ--------------------------
O43521_BCL2L11-06      FDTDRSPAPMSCDKSTQTPSPPCQAFNH---YLSAM-----VREIEEVVV
O43521_BCL2L11-18      FDTDRSPAPMSCDKSTQTPSPPCQAFNH---YLSAM-----VREIEEVVV
O43521_BCL2L11-08      FDTDRSPAPMSCDKSTQTPSPPCQAFNH---YLSAM-----ANWD-----
O43521_BCL2L11-21      FDTDRSPAPMSCDKSTQTPSPPCQAFNH---YLSAM-----ANWD-----
O43521_BCL2L11-12      FDTDRSPAPMSCDKSTQTPSPPCQAFNH---YLSAM-----GIFE-----
O43521_BCL2L11-20      -----------------------------------------ASMRQAEPA
O43521_BCL2L11-07      -----------------------------------------ASMRQAEPA
O43521_BCL2L11-22      -----------------------------------------ASMRQAEPA
O43521_BCL2L11-02      ---DRSPAPMSCDKSTQTPSPPCQAFNH---YLSAM------VVILEDIG
O43521_BCL2L11-15      ---DRSPAPMSCDKSTQTPSPPCQAFNH---YLSAM------VVILEDIG
O43521_BCL2L11-09      ---DRSPAPMSCDKSTQTPSPPCQAFNH---YLSAM-----ASMRQAEPA
O43521_BCL2L11-14      ---DRSPAPMSCDKSTQTPSPPCQAFNH---YLSAM-----ASMRQAEPA
O43521_BCL2L11-17      ---DRSPAPMSCDKSTQTPSPPCQAFNH---YLSAMVREIEEVVV-----
O43521_BCL2L11-03      ---DRSPAPMSCDKSTQTPSPPCQAFNH---YLSAMDDSAGSSLRIALHR
O43521_BCL2L11-23      ---DRSPAPMSCDKSTQTPSPPCQAFNH---YLSAMDDSAGSSLRIALHR
O43521_BCL2L11-13      ---GNPEGNHGGEGDSCPHG-----------------SPQGPLAPPASPG
O43521_BCL2L11-16      ---VS----------LCHPGWSALVRSW---LTATSNSQVQAVLLPQPPK
Q6JTU4_BCL2L11-01      --------------------------------------------------
Q13794_PMAIP1-01       --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
Q92934_BAD-05          --------------------------------------------------
                                                                         

O00198_HRK-03          --------------------------------------------------
Q96LC9_BMF-09          --------------------------------------------------
Q9BXH1_BBC3-03         --------------------------------------------------
Q96LC9_BMF-05          CFEWRREQE-----------------------------------------
Q96LC9_BMF-07          CFEWRREQE-----------------------------------------
Q96LC9_BMF-06          EGQWQHQAE---------------------HQQNQNRVWWQILLFLHNLA
Q96LC9_BMF-01          EGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLA
Q96LC9_BMF-02          EGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLA
Q96LC9_BMF-03          EGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLA
Q96LC9_BMF-04          EGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLA
Q13323_BIK-01          MDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKEN
Q92934_BAD-03          EERGHSNADAAKLQLDASLPVLVGSELGQGK-LRPLPVTFA---------
Q92934_BAD-04          D--SENPSAGMLAEASAGMSAPAADSEAQ-H-AENVKLEALGLW---RSG
B4DZQ9_BAD-01          EGMGEEPSPFRGRSRSAPPNLWAAQRYGR-E-LRRMSDEFVDSF---KKG
Q92934_BAD-01          EGMGEEPSPFRGRSRSAPPNLWAAQRYGR-E-LRRMSDEFVDSF---KKG
Q92934_BAD-02          EGMGEEPSPFRGRSRSAPPNLWAAQRYGR-E-LRRMSDEFVDSF---KKG
Q9BXH1_BBC3-05         VRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLI
Q9BXH1_BBC3-04         --------------------------------------------------
O00198_HRK-01          GRRNL---------------------------------------------
B4DQK3_BBC3-01         VRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLI
Q9BXH1_BBC3-06         VRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLI
Q13794_PMAIP1-02       DIQ---------------------TLLLRNLTASKTCMRGLLQKSFLRRC
O43521_BCL2L11-04      DMR-PEIW---IAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRL
O43521_BCL2L11-05      DMR-PEIW---IAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRL
O43521_BCL2L11-10      DMR-PEIW---IAQELRRIGDEFNAYYARRLEK-----------------
O43521_BCL2L11-11      DMR-PEIW---IAQELRRIGDEFNAYYARRMPLPPD--------------
O43521_BCL2L11-19      DMR-PEIW---IAQELRRIGDEFNAYYARRMPLPPD--------------
O43521_BCL2L11-01      --------------------------------------------------
O43521_BCL2L11-06      --------------------------------------------------
O43521_BCL2L11-18      --------------------------------------------------
O43521_BCL2L11-08      --------------------------------------------------
O43521_BCL2L11-21      --------------------------------------------------
O43521_BCL2L11-12      --------------------------------------------------
O43521_BCL2L11-20      DMR-PEIW---IAQELRRIGDEFNAYYARRMPLPPD--------------
O43521_BCL2L11-07      DMR-PEIW---IAQELRRIGDEFNAYYARRLAKLLASST-----------
O43521_BCL2L11-22      DMR-PEIW---IAQELRRIGDEFNAYYARRLAKLLASST-----------
O43521_BCL2L11-02      DLSLCFGF---IFTGLDLYGHHHSQDTEQLNHKDFS--------------
O43521_BCL2L11-15      DLSLCFGF---IFTGLDLYGHHHSQDTEQLNHKDFS--------------
O43521_BCL2L11-09      DMR-PEIW---IAQELRRIGDEFNAYYARRLEK-----------------
O43521_BCL2L11-14      DMR-PEIW---IAQELRRIGDEFNAYYARRLEK-----------------
O43521_BCL2L11-17      --------------------------------------------------
O43521_BCL2L11-03      EVQWPLKW---LAKSS----------------------------------
O43521_BCL2L11-23      EVQWPLKW---LAKSS----------------------------------
O43521_BCL2L11-13      --------------------------------------------------
O43521_BCL2L11-16      --------------------------------------------------
Q6JTU4_BCL2L11-01      -----------IAQELRRIGDEFNAYYARRLEK-----------------
Q13794_PMAIP1-01       -----------FGDKL-----NFRQKLLNLISKLFCSGT-----------
Q96LC9_BMF-08          -----------FAQSLLDCPLSRLQLF----PLTHCCGPGLR--------
Q92934_BAD-06          -----------YGRELRRMSDEFVDSFKKGLPRPKSAG------------
Q92934_BAD-05          -----------YGRELRRMSDEFVDSFKKGLPRPKSAGTATQMRQSSSWT
                                                                         

O00198_HRK-03          --------------------------------------------------
Q96LC9_BMF-09          --------------------------------------------------
Q9BXH1_BBC3-03         --------------------------------------------------
Q96LC9_BMF-05          ---------RGRP-------------------------------------
Q96LC9_BMF-07          ---------RGRP-------------------------------------
Q96LC9_BMF-06          LNGEENRNGAGPR-------------------------------------
Q96LC9_BMF-01          LNGEENRNGAGPR-------------------------------------
Q96LC9_BMF-02          LNGEENRNGAGPR-------------------------------------
Q96LC9_BMF-03          LNGEENRNGAGPR-------------------------------------
Q96LC9_BMF-04          LNGEENRNGAGPR-------------------------------------
Q13323_BIK-01          IMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK-------
Q92934_BAD-03          ----PHPETPPVPTALGSHLEYGR---KYFPQAYAKRGSVLSPLEGGLTQ
Q92934_BAD-04          VATAPTPRGRRTTKGWGRSPAPFGAARARRPPTSGQHSAMAASSGG----
B4DZQ9_BAD-01          L---PRPKSAGTATQMRQSPRRLR--------------------------
Q92934_BAD-01          L---PRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ-------
Q92934_BAD-02          L---PRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ-------
Q9BXH1_BBC3-05         MGLLPLPRGHRAPEMEPN--------------------------------
Q9BXH1_BBC3-04         --------------------------------------------------
O00198_HRK-01          --------------------------------------------------
B4DQK3_BBC3-01         MGLLPLPRGHRAPEMEPN--------------------------------
Q9BXH1_BBC3-06         MGLLPLPRGHRAPEMEPN--------------------------------
Q13794_PMAIP1-02       TFHQFEERLHCN--------------------------------------
O43521_BCL2L11-04      LRYIVRLVWRMH--------------------------------------
O43521_BCL2L11-05      LRYIVRLVWRMH--------------------------------------
O43521_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-11      --------------------------------------------------
O43521_BCL2L11-19      --------------------------------------------------
O43521_BCL2L11-01      --------------------------------------------------
O43521_BCL2L11-06      --------------------------------------------------
O43521_BCL2L11-18      --------------------------------------------------
O43521_BCL2L11-08      --------------------------------------------------
O43521_BCL2L11-21      --------------------------------------------------
O43521_BCL2L11-12      --------------------------------------------------
O43521_BCL2L11-20      --------------------------------------------------
O43521_BCL2L11-07      --------------------------------------------------
O43521_BCL2L11-22      --------------------------------------------------
O43521_BCL2L11-02      --------------------------------------------------
O43521_BCL2L11-15      --------------------------------------------------
O43521_BCL2L11-09      --------------------------------------------------
O43521_BCL2L11-14      --------------------------------------------------
O43521_BCL2L11-17      --------------------------------------------------
O43521_BCL2L11-03      --------------------------------------------------
O43521_BCL2L11-23      --------------------------------------------------
O43521_BCL2L11-13      --------------------------------------------------
O43521_BCL2L11-16      --------------------------------------------------
Q6JTU4_BCL2L11-01      --------------------------------------------------
Q13794_PMAIP1-01       --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
Q92934_BAD-06          --------------------------------------------------
Q92934_BAD-05          R-------------------------------------------------
                                                                         

O00198_HRK-03          ------
Q96LC9_BMF-09          ------
Q9BXH1_BBC3-03         ------
Q96LC9_BMF-05          ------
Q96LC9_BMF-07          ------
Q96LC9_BMF-06          ------
Q96LC9_BMF-01          ------
Q96LC9_BMF-02          ------
Q96LC9_BMF-03          ------
Q96LC9_BMF-04          ------
Q13323_BIK-01          ------
Q92934_BAD-03          IPFRCV
Q92934_BAD-04          ------
B4DZQ9_BAD-01          ------
Q92934_BAD-01          ------
Q92934_BAD-02          ------
Q9BXH1_BBC3-05         ------
Q9BXH1_BBC3-04         ------
O00198_HRK-01          ------
B4DQK3_BBC3-01         ------
Q9BXH1_BBC3-06         ------
Q13794_PMAIP1-02       ------
O43521_BCL2L11-04      ------
O43521_BCL2L11-05      ------
O43521_BCL2L11-10      ------
O43521_BCL2L11-11      ------
O43521_BCL2L11-19      ------
O43521_BCL2L11-01      ------
O43521_BCL2L11-06      ------
O43521_BCL2L11-18      ------
O43521_BCL2L11-08      ------
O43521_BCL2L11-21      ------
O43521_BCL2L11-12      ------
O43521_BCL2L11-20      ------
O43521_BCL2L11-07      ------
O43521_BCL2L11-22      ------
O43521_BCL2L11-02      ------
O43521_BCL2L11-15      ------
O43521_BCL2L11-09      ------
O43521_BCL2L11-14      ------
O43521_BCL2L11-17      ------
O43521_BCL2L11-03      ------
O43521_BCL2L11-23      ------
O43521_BCL2L11-13      ------
O43521_BCL2L11-16      ------
Q6JTU4_BCL2L11-01      ------
Q13794_PMAIP1-01       ------
Q96LC9_BMF-08          ------
Q92934_BAD-06          ------
Q92934_BAD-05          ------
                             

© 1998-2022Legal notice