Dataset for protein classical BH3-containing proteins of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

41 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q96LC9_BMF-09          -------------MEPSQCVEE----------------------------
Q9BXH1_BBC3-06         MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRG
B4DZQ9_BAD-01          -------MFQIPEFEPSEQEDS-----SSAERGLG---------------
Q96LC9_BMF-05          -------------MEPSQCVEE--------LEDDV---------------
Q96LC9_BMF-07          -------------MEPSQCVEE--------LEDDV---------------
Q96LC9_BMF-06          -------------MEPSQCVEE--------LEDDV---------------
Q96LC9_BMF-04          -------------MEPSQCVEE--------LEDDV---------------
Q96LC9_BMF-03          -------------MEPSQCVEE--------LEDDV---------------
Q96LC9_BMF-02          -------------MEPSQCVEE--------LEDDV---------------
Q96LC9_BMF-01          -------------MEPSQCVEE--------LEDDV---------------
Q9BXH1_BBC3-05         MKFGMGSAQACPCQVPRAASTTWVPCQICGPQ-PS---------------
Q9BXH1_BBC3-04         MKFGMGSAQACPCQVPRAASTTWVPCQICETRGAA---------------
B4DQK3_BBC3-01         -------------MAPGSAMAR------ARQEGSS---------------
Q9BXH1_BBC3-03         -------------------MAR------ARQEGSS---------------
Q13794_PMAIP1-02       ------------------------------MPGKK---------------
O43521_BCL2L11-01      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-06      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-18      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-12      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-08      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-21      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-05      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-10      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-11      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-19      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-03      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-23      -------------KQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-15      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-02      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-04      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-14      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-09      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-16      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-13      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-17      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-07      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-22      -----------MAKQPSDVSSE------CDREGRQ---------------
O43521_BCL2L11-20      -----------MAKQPSDVSSE------CDREGRQ---------------
Q6JTU4_BCL2L11-01      ----------MRQAEPADMRPEIWI-------AQE---------------
Q13794_PMAIP1-01       --MPGKKARKNAQPSPARAPAELEVEC-----ATQ---------------
Q96LC9_BMF-08          -------------MEPSQCVEELEDDVFQPEDGEP---------------
                                                                         

Q96LC9_BMF-09          --------------------------------------------------
Q9BXH1_BBC3-06         PGPRRPAPLPARPPGALGSVLRPLRARPGCRPRRPHPAARCLPLRPHRPT
B4DZQ9_BAD-01          --------------------------------------------------
Q96LC9_BMF-05          --------------------------------------------------
Q96LC9_BMF-07          --------------------------------------------------
Q96LC9_BMF-06          --------------------------------------------------
Q96LC9_BMF-04          --------------------------------------------------
Q96LC9_BMF-03          --------------------------------------------------
Q96LC9_BMF-02          --------------------------------------------------
Q96LC9_BMF-01          --------------------------------------------------
Q9BXH1_BBC3-05         --------------------------------------------------
Q9BXH1_BBC3-04         --------------------------------------------------
B4DQK3_BBC3-01         --------------------------------------------------
Q9BXH1_BBC3-03         --------------------------------------------------
Q13794_PMAIP1-02       --------------------------------------------------
O43521_BCL2L11-01      --------------------------------------------------
O43521_BCL2L11-06      --------------------------------------------------
O43521_BCL2L11-18      --------------------------------------------------
O43521_BCL2L11-12      --------------------------------------------------
O43521_BCL2L11-08      --------------------------------------------------
O43521_BCL2L11-21      --------------------------------------------------
O43521_BCL2L11-05      --------------------------------------------------
O43521_BCL2L11-10      --------------------------------------------------
O43521_BCL2L11-11      --------------------------------------------------
O43521_BCL2L11-19      --------------------------------------------------
O43521_BCL2L11-03      --------------------------------------------------
O43521_BCL2L11-23      --------------------------------------------------
O43521_BCL2L11-15      --------------------------------------------------
O43521_BCL2L11-02      --------------------------------------------------
O43521_BCL2L11-04      --------------------------------------------------
O43521_BCL2L11-14      --------------------------------------------------
O43521_BCL2L11-09      --------------------------------------------------
O43521_BCL2L11-16      --------------------------------------------------
O43521_BCL2L11-13      --------------------------------------------------
O43521_BCL2L11-17      --------------------------------------------------
O43521_BCL2L11-07      --------------------------------------------------
O43521_BCL2L11-22      --------------------------------------------------
O43521_BCL2L11-20      --------------------------------------------------
Q6JTU4_BCL2L11-01      --------------------------------------------------
Q13794_PMAIP1-01       --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
                                                                         

Q96LC9_BMF-09          ---------------LEDD-------------------------------
Q9BXH1_BBC3-06         RRHRRPGGFPLAWGSPQPAP-------------------------RPAPG
B4DZQ9_BAD-01          ---------------PSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSS
Q96LC9_BMF-05          ---------------FQPED-------------------------GEPVT
Q96LC9_BMF-07          ---------------FQPED-------------------------GEPVT
Q96LC9_BMF-06          ---------------FQPED-------------------------GEPVT
Q96LC9_BMF-04          ---------------FQPED-------------------------GEPVT
Q96LC9_BMF-03          ---------------FQPED-------------------------GEPVT
Q96LC9_BMF-02          ---------------FQPED-------------------------GEPVT
Q96LC9_BMF-01          ---------------FQPED-------------------------GEPVT
Q9BXH1_BBC3-05         ---------------LSLAE-------------------------QHLES
Q9BXH1_BBC3-04         ---------------AAPPLTLE----------------------GPVQS
B4DQK3_BBC3-01         ---------------PEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLA
Q9BXH1_BBC3-03         ---------------PEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLA
Q13794_PMAIP1-02       ---------------ARKNA-------------------------QPSPA
O43521_BCL2L11-01      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-06      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-18      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-12      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-08      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-21      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-05      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-10      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-11      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-19      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-03      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-23      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-15      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-02      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-04      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-14      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-09      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-16      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-13      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-17      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-07      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-22      ---------------LQPAE-------------------------RPPQL
O43521_BCL2L11-20      ---------------LQPAE-------------------------RPPQL
Q6JTU4_BCL2L11-01      -------------------------------------------------L
Q13794_PMAIP1-01       -------------------------------------------------L
Q96LC9_BMF-08          -------------------------------------------------V
                                                                         

Q96LC9_BMF-09          --------------------------------------------------
Q9BXH1_BBC3-06         RSSALALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPA
B4DZQ9_BAD-01          SHHGGAGAVEIRSR------------------------------------
Q96LC9_BMF-05          Q-PGSLLSADLFAQ------------------------------------
Q96LC9_BMF-07          Q-PGSLLSADLFAQ------------------------------------
Q96LC9_BMF-06          Q-PGSLLSADLFAQ------------------------------------
Q96LC9_BMF-04          Q-PGSLLSADLFAQ------------------------------------
Q96LC9_BMF-03          Q-PGSLLSADLFAQ------------------------------------
Q96LC9_BMF-02          Q-PGSLLSADLFAQ------------------------------------
Q96LC9_BMF-01          Q-PGSLLSADLFAQ------------------------------------
Q9BXH1_BBC3-05         PVPSAPGALAGGPT------------------------------------
Q9BXH1_BBC3-04         H-HGTP-ALTQGPQSPRDGAQLGA--------------------------
B4DQK3_BBC3-01         AAPAAPTLLPAAYLCAPTAPPAVTAALGGSRWPGGPRS------------
Q9BXH1_BBC3-03         AAPAAPTLLPAAYLCAPTAPPAVTAALGGSRWPGGPRS------------
Q13794_PMAIP1-02       RAPAGPAGTAGTARDQAGFAIG----------------------------
O43521_BCL2L11-01      R-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA------------
O43521_BCL2L11-06      R-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA------------
O43521_BCL2L11-18      R-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA------------
O43521_BCL2L11-12      R-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA------------
O43521_BCL2L11-08      R-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA------------
O43521_BCL2L11-21      R-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA------------
O43521_BCL2L11-05      R-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA------------
O43521_BCL2L11-10      R-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA------------
O43521_BCL2L11-11      R-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA------------
O43521_BCL2L11-19      R-PGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLA------------
O43521_BCL2L11-03      R-PGAPTSLQTEPQ------------------------------------
O43521_BCL2L11-23      R-PGAPTSLQTEPQ------------------------------------
O43521_BCL2L11-15      R-PGAPTSLQTEPQ------------------------------------
O43521_BCL2L11-02      R-PGAPTSLQTEPQ------------------------------------
O43521_BCL2L11-04      R-PGAPTSLQTEPQ------------------------------------
O43521_BCL2L11-14      R-PGAPTSLQTEPQ------------------------------------
O43521_BCL2L11-09      R-PGAPTSLQTEPQ------------------------------------
O43521_BCL2L11-16      R-PGAPTSLQTEPQ------------------------------------
O43521_BCL2L11-13      R-PGAPTSLQTEPQ------------------------------------
O43521_BCL2L11-17      R-PGAPTSLQTEPQ------------------------------------
O43521_BCL2L11-07      R-PGAPTSLQTEPQ------------------------------------
O43521_BCL2L11-22      R-PGAPTSLQTEPQ------------------------------------
O43521_BCL2L11-20      R-PGAPTSLQTEPQ------------------------------------
Q6JTU4_BCL2L11-01      RRIGDEFNAY-YAR------------------------------------
Q13794_PMAIP1-01       RRFGDKLN---FRQ------------------------------------
Q96LC9_BMF-08          TQPGSLLSADLFAQ------------------------------------
                                                                         

Q96LC9_BMF-09          --------------------------------------------------
Q9BXH1_BBC3-06         AADGGRPQRTVRAAETRGAAAAPPLTLEGPVQSHHGTPALTQGPQSPRDG
B4DZQ9_BAD-01          --------------------------------------------------
Q96LC9_BMF-05          ------------------------SLLDCPLSRLQLFPLTHCCGPGLRPT
Q96LC9_BMF-07          ------------------------SLLDCPLSRLQLFPLTHCCGPGLRPT
Q96LC9_BMF-06          ------------------------SLLDCPLSRLQLFPLTHCCGPGLRPT
Q96LC9_BMF-04          ------------------------SLLDCPLSRLQLFPLTHCCGPGLRPT
Q96LC9_BMF-03          ------------------------SLLDCPLSRLQLFPLTHCCGPGLRPT
Q96LC9_BMF-02          ------------------------SLLDCPLSRLQLFPLTHCCGPGLRPT
Q96LC9_BMF-01          ------------------------SLLDCPLSRLQLFPLTHCCGPGLRPT
Q9BXH1_BBC3-05         --------------------------------------------------
Q9BXH1_BBC3-04         --------------------------------------------------
B4DQK3_BBC3-01         -----------------RPRGPRPDGPQPSL------------------S
Q9BXH1_BBC3-03         -----------------RPRGPRPDGPQPSL------------------S
Q13794_PMAIP1-02       ---------------------------------------MQLRFTRGKKL
O43521_BCL2L11-01      -----------------PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS
O43521_BCL2L11-06      -----------------PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS
O43521_BCL2L11-18      -----------------PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS
O43521_BCL2L11-12      -----------------PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS
O43521_BCL2L11-08      -----------------PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS
O43521_BCL2L11-21      -----------------PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS
O43521_BCL2L11-05      -----------------PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS
O43521_BCL2L11-10      -----------------PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS
O43521_BCL2L11-11      -----------------PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS
O43521_BCL2L11-19      -----------------PPASPGPFATRSPLFIFMRRSSLLSRSSSGYFS
O43521_BCL2L11-03      --------------------------------------------------
O43521_BCL2L11-23      --------------------------------------------------
O43521_BCL2L11-15      --------------------------------------------------
O43521_BCL2L11-02      --------------------------------------------------
O43521_BCL2L11-04      --------------------------------------------------
O43521_BCL2L11-14      --------------------------------------------------
O43521_BCL2L11-09      --------------------------------------------------
O43521_BCL2L11-16      --------------------------------------------------
O43521_BCL2L11-13      --------------------------------------------------
O43521_BCL2L11-17      --------------------------------------------------
O43521_BCL2L11-07      --------------------------------------------------
O43521_BCL2L11-22      --------------------------------------------------
O43521_BCL2L11-20      --------------------------------------------------
Q6JTU4_BCL2L11-01      ------------------------RLEK----------------------
Q13794_PMAIP1-01       ------------------------KLLN-------LISKLFCSGT-----
Q96LC9_BMF-08          ------------------------SLLDCPLSRLQLFPLTHCCGPGLR--
                                                                         

Q96LC9_BMF-09          --------------------------------------------------
Q9BXH1_BBC3-06         AQLGACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM--------------
B4DZQ9_BAD-01          ----HSSYPAGTEDDEGMGEEPSPF-------------RGRSRSAPPNLW
Q96LC9_BMF-05          SQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAP--AE-----PKSCV
Q96LC9_BMF-07          SQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAP--AE-----PKSCV
Q96LC9_BMF-06          SQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGN--AGYRLPLPASFP
Q96LC9_BMF-04          SQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGN--AGYRLPLPASFP
Q96LC9_BMF-03          SQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGN--AGYRLPLPASFP
Q96LC9_BMF-02          SQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGN--AGYRLPLPASFP
Q96LC9_BMF-01          SQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGN--AGYRLPLPASFP
Q9BXH1_BBC3-05         --------------------------------------QAAPGVRGEEEQ
Q9BXH1_BBC3-04         -----CTRPVDVRDSGGRPLPPPDTLASAGDFLCTM--------------
B4DQK3_BBC3-01         LAEQHLESPVPSAPGALAGGPT----------------QAAPGVRGEEEQ
Q9BXH1_BBC3-03         LAEQHLESPVPSAPGALAGGPT----------------QAAPGVRGEEEQ
Q13794_PMAIP1-02       LSSSLSSSPLALPRGHEEQ-------------------VQVAGSRVCYST
O43521_BCL2L11-01      FDTDRSPAPMSCDKSTQTPSPPCQ--------------------------
O43521_BCL2L11-06      FDTDRSPAPMSCDKSTQTPSPPCQAF---NHYLSAM--VREIEEVVV---
O43521_BCL2L11-18      FDTDRSPAPMSCDKSTQTPSPPCQAF---NHYLSAM--VREIEEVVV---
O43521_BCL2L11-12      FDTDRSPAPMSCDKSTQTPSPPCQAF---NHYLSAM--GIFE--------
O43521_BCL2L11-08      FDTDRSPAPMSCDKSTQTPSPPCQAF---NHYLSAM--ANWD--------
O43521_BCL2L11-21      FDTDRSPAPMSCDKSTQTPSPPCQAF---NHYLSAM--ANWD--------
O43521_BCL2L11-05      FDTDRSPAPMSCDKSTQTPSPPCQAF---NHYLSAM--ASMRQAEPADMR
O43521_BCL2L11-10      FDTDRSPAPMSCDKSTQTPSPPCQAF---NHYLSAM--ASMRQAEPADMR
O43521_BCL2L11-11      FDTDRSPAPMSCDKSTQTPSPPCQAF---NHYLSAM--ASMRQAEPADMR
O43521_BCL2L11-19      FDTDRSPAPMSCDKSTQTPSPPCQAF---NHYLSAM--ASMRQAEPADMR
O43521_BCL2L11-03      ---DRSPAPMSCDKSTQTPSPPCQAF---NHYLSAMDDSAGSSLRIALHR
O43521_BCL2L11-23      ---DRSPAPMSCDKSTQTPSPPCQAF---NHYLSAMDDSAGSSLRIALHR
O43521_BCL2L11-15      ---DRSPAPMSCDKSTQTPSPPCQAF---NHYLSAM--VVI---------
O43521_BCL2L11-02      ---DRSPAPMSCDKSTQTPSPPCQAF---NHYLSAM--VVI---------
O43521_BCL2L11-04      ---DRSPAPMSCDKSTQTPSPPCQAF---NHYLSAM--ASMRQAEPADMR
O43521_BCL2L11-14      ---DRSPAPMSCDKSTQTPSPPCQAF---NHYLSAM--ASMRQAEPADMR
O43521_BCL2L11-09      ---DRSPAPMSCDKSTQTPSPPCQAF---NHYLSAM--ASMRQAEPADMR
O43521_BCL2L11-16      --------------------------------------VSLCHPGWSALV
O43521_BCL2L11-13      --------------------------------------GNPEGNHGGE--
O43521_BCL2L11-17      --------------------------------------DRSPAPMSCDKS
O43521_BCL2L11-07      --------------------------------------ASMRQAEPADMR
O43521_BCL2L11-22      --------------------------------------ASMRQAEPADMR
O43521_BCL2L11-20      --------------------------------------ASMRQAEPADMR
Q6JTU4_BCL2L11-01      --------------------------------------------------
Q13794_PMAIP1-01       --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
                                                                         

Q96LC9_BMF-09          --------------------------------------------------
Q9BXH1_BBC3-06         --------------------------------------------------
B4DZQ9_BAD-01          AAQRYGRELRRMS-------------DEFVDSFKKGLPRPKSAGTATQMR
Q96LC9_BMF-05          VADPPLPAQPCFEWRREQE-------------------------------
Q96LC9_BMF-07          VADPPLPAQPCFEWRREQE-------------------------------
Q96LC9_BMF-06          AVLPIGEQPPEGQWQHQAE---------------------HQQNQNRVWW
Q96LC9_BMF-04          AVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWW
Q96LC9_BMF-03          AVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWW
Q96LC9_BMF-02          AVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWW
Q96LC9_BMF-01          AVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWW
Q9BXH1_BBC3-05         WAREIGAQLRRMA-------------DDLNAQYERRRQEEQQRHRPSPWR
Q9BXH1_BBC3-04         --------------------------------------------------
B4DQK3_BBC3-01         WAREIGAQLRRMA-------------DDLNAQYERRRQEEQQRHRPSPWR
Q9BXH1_BBC3-03         WAREIGAQLRRMA-------------DDLNAQYERRRQEEQQRHRPSPWR
Q13794_PMAIP1-02       QEIWRQTELPAET-----------SESDIQTLLLRNLTASKTCMRGLLQK
O43521_BCL2L11-01      --------------------------------------------------
O43521_BCL2L11-06      --------------------------------------------------
O43521_BCL2L11-18      --------------------------------------------------
O43521_BCL2L11-12      --------------------------------------------------
O43521_BCL2L11-08      --------------------------------------------------
O43521_BCL2L11-21      --------------------------------------------------
O43521_BCL2L11-05      PEIWIAQELRRIG-------------DEFNAYYARRVFLNNYQAAEDHPR
O43521_BCL2L11-10      PEIWIAQELRRIG-------------DEFNAYYARRLEK-----------
O43521_BCL2L11-11      PEIWIAQELRRIG-------------DEFNAYYARRMPLPPD--------
O43521_BCL2L11-19      PEIWIAQELRRIG-------------DEFNAYYARRMPLPPD--------
O43521_BCL2L11-03      EVQWPLKWLAKSS-------------------------------------
O43521_BCL2L11-23      EVQWPLKWLAKSS-------------------------------------
O43521_BCL2L11-15      --------LEDIGDLSLCFGFIFTGLDLYGHHHSQDTEQLNHKDFS----
O43521_BCL2L11-02      --------LEDIGDLSLCFGFIFTGLDLYGHHHSQDTEQLNHKDFS----
O43521_BCL2L11-04      PEIWIAQELRRIG-------------DEFNAYYARRVFLNNYQAAEDHPR
O43521_BCL2L11-14      PEIWIAQELRRIG-------------DEFNAYYARRLEK-----------
O43521_BCL2L11-09      PEIWIAQELRRIG-------------DEFNAYYARRLEK-----------
O43521_BCL2L11-16      RSWLTATSNSQV-----------------------QAVLLPQPPK-----
O43521_BCL2L11-13      ------------G-------------DSCPHGSPQGPLAPPASPG-----
O43521_BCL2L11-17      -----TQTPSPPC-------------QAFNHYLSAMVREIEEVVV-----
O43521_BCL2L11-07      PEIWIAQELRRIG-------------DEFNAYYARRLAKLLASST-----
O43521_BCL2L11-22      PEIWIAQELRRIG-------------DEFNAYYARRLAKLLASST-----
O43521_BCL2L11-20      PEIWIAQELRRIG-------------DEFNAYYARRMPLPPD--------
Q6JTU4_BCL2L11-01      --------------------------------------------------
Q13794_PMAIP1-01       --------------------------------------------------
Q96LC9_BMF-08          --------------------------------------------------
                                                                         

Q96LC9_BMF-09          ------------------------
Q9BXH1_BBC3-06         ------------------------
B4DZQ9_BAD-01          QSPRRLR-----------------
Q96LC9_BMF-05          -------------------RGRP-
Q96LC9_BMF-07          -------------------RGRP-
Q96LC9_BMF-06          QILLFLHNLALNGEENRNGAGPR-
Q96LC9_BMF-04          QILLFLHNLALNGEENRNGAGPR-
Q96LC9_BMF-03          QILLFLHNLALNGEENRNGAGPR-
Q96LC9_BMF-02          QILLFLHNLALNGEENRNGAGPR-
Q96LC9_BMF-01          QILLFLHNLALNGEENRNGAGPR-
Q9BXH1_BBC3-05         VLYNLIMGLLPLPRGHRAPEMEPN
Q9BXH1_BBC3-04         ------------------------
B4DQK3_BBC3-01         VLYNLIMGLLPLPRGHRAPEMEPN
Q9BXH1_BBC3-03         VLYNLIMGLLPLPRGHRAPEMEPN
Q13794_PMAIP1-02       SFLRRCTFHQFEERLHCN------
O43521_BCL2L11-01      ------------------------
O43521_BCL2L11-06      ------------------------
O43521_BCL2L11-18      ------------------------
O43521_BCL2L11-12      ------------------------
O43521_BCL2L11-08      ------------------------
O43521_BCL2L11-21      ------------------------
O43521_BCL2L11-05      MVILRLLRYIVRLVWRMH------
O43521_BCL2L11-10      ------------------------
O43521_BCL2L11-11      ------------------------
O43521_BCL2L11-19      ------------------------
O43521_BCL2L11-03      ------------------------
O43521_BCL2L11-23      ------------------------
O43521_BCL2L11-15      ------------------------
O43521_BCL2L11-02      ------------------------
O43521_BCL2L11-04      MVILRLLRYIVRLVWRMH------
O43521_BCL2L11-14      ------------------------
O43521_BCL2L11-09      ------------------------
O43521_BCL2L11-16      ------------------------
O43521_BCL2L11-13      ------------------------
O43521_BCL2L11-17      ------------------------
O43521_BCL2L11-07      ------------------------
O43521_BCL2L11-22      ------------------------
O43521_BCL2L11-20      ------------------------
Q6JTU4_BCL2L11-01      ------------------------
Q13794_PMAIP1-01       ------------------------
Q96LC9_BMF-08          ------------------------
                                               

© 1998-2022Legal notice