Dataset for protein classical BH3-containing proteins of organism Homo sapiens

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q6JTU4_BCL2L11-01      -------------------------------------------------M
Q9BXH1_BBC3-03         MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPG--AR
B4DQK3_BBC3-01         ---MAPGSAMARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCE
B4DZQ9_BAD-01          ---MFQIPEFEPSEQEDSSS----------------------------AE
A8MXU7_BAD-04          ---MFQIPEFEPSEQEDSSS----------------------------AE
A8MXU7_BAD-03          ---MFQIPEFEPSEQEDSSS----------------------------AE
O43521_BCL2L11-20      -----------MAKQPSDVSSE------C-------------------DR
Q9BXH1_BBC3-04         MKFGMGSAQACPCQVPRAASTTWVPCQIC-------------------ET
                                                                         

Q6JTU4_BCL2L11-01      RQAEPADMRP----------------------------------------
Q9BXH1_BBC3-03         RGPGPRRPAPLPARPPGALGSVLRPLRARPGCRPRRPHPAARCLPLRPHR
B4DQK3_BBC3-01         PGLAAAPAAPTLLPAAYLCA---------------------------PTA
B4DZQ9_BAD-01          RGLGPSPAGD---------G---------------------------PSG
A8MXU7_BAD-04          RGLGPSPAGD---------G---------------------------PSG
A8MXU7_BAD-03          RGLGPSPAGD---------G---------------------------PSG
O43521_BCL2L11-20      EGRQLQPA----------------------------------------ER
Q9BXH1_BBC3-04         RGAAAAPPLT-------------------------------------LEG
                                                                         

Q6JTU4_BCL2L11-01      ------------EIWIAQE-------------------------------
Q9BXH1_BBC3-03         PTRRHRRPGGFPLAWGSPQPAPRPAPGRSSALALAGGAAPGVARAQRPGG
B4DQK3_BBC3-01         PPAVTAALGG--SRWPGG-PRSRPRGPRPD-----GPQPSLSLAEQHLES
B4DZQ9_BAD-01          SGKHHRQAPG--LLWDASHQQEQPTSSSHH-----GGAGAVEIRSRHSSY
A8MXU7_BAD-04          SGKHHRQAPG--LLWDASHQQEQPTSSSHH-----GGRTSYSPSWESEDS
A8MXU7_BAD-03          SGKHHRQAPG--LLWDASHQQEQPTSSSHH-----GEGTSSPEERGHSNA
O43521_BCL2L11-20      PPQLRPGAPT----------------------------------------
Q9BXH1_BBC3-04         PVQSHHGTP-----------------------------------------
                                                                         

Q6JTU4_BCL2L11-01      --------------------------------------------------
Q9BXH1_BBC3-03         SGGRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQR--------------
B4DQK3_BBC3-01         PVPS--------------------APGALAGGP-----------------
B4DZQ9_BAD-01          PAGT-------------EDDEGMGEEPSPFRGR-----------------
A8MXU7_BAD-04          ENPSAGMLA--------EASAGMSAPAADSEAQHAENVKLEALGLWRSGV
A8MXU7_BAD-03          DAAKLQLDASLPVLVGSELGQGKLRPLPVTFAPHPE--------------
O43521_BCL2L11-20      --------------------------------------------------
Q9BXH1_BBC3-04         --------------------------------------------------
                                                                         

Q6JTU4_BCL2L11-01      ----------------------LRRIGDEFNAYYARRLEK----------
Q9BXH1_BBC3-03         -TVRAAETRGAAAAPPLT----LEGPVQSHHGTPALTQGPQS--------
B4DQK3_BBC3-01         -TQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPW
B4DZQ9_BAD-01          -SRSAPPNLWAAQRYGRE----LRRMSDEFVDSF-KKGLPRP--------
A8MXU7_BAD-04          ATAPTPRGRRTTKGWGRS------------PAPFGAARARRP--------
A8MXU7_BAD-03          -TPPVPTALGSHLEYGRK----Y------FPQAYAKRGSVLS--------
O43521_BCL2L11-20      ----------------------------------SLQTEPQV--------
Q9BXH1_BBC3-04         ----------------------------------ALTQGPQS--------
                                                                         

Q6JTU4_BCL2L11-01      --------------------------------------------------
Q9BXH1_BBC3-03         -----------PRDGAQLGACTRPVDVRDSGGR------PLPPPDTLASA
B4DQK3_BBC3-01         RVLYNLIMGLLPLPRGHRAPEMEPN-------------------------
B4DZQ9_BAD-01          -----------KSAGTATQMRQSPRRLR----------------------
A8MXU7_BAD-04          -----------PTSGQHSAMAASSGG------------------------
A8MXU7_BAD-03          -----------PLEGGLTQIPFRCV-------------------------
O43521_BCL2L11-20      -----------SLCHPGWSALVRSWLTATSNSQVQAVLLPQPPK------
Q9BXH1_BBC3-04         -----------PRDGAQLGACTRPVDVRDSGGR------PLPPPDTLASA
                                                                         

Q6JTU4_BCL2L11-01      -------
Q9BXH1_BBC3-03         GDFLCTM
B4DQK3_BBC3-01         -------
B4DZQ9_BAD-01          -------
A8MXU7_BAD-04          -------
A8MXU7_BAD-03          -------
O43521_BCL2L11-20      -------
Q9BXH1_BBC3-04         GDFLCTM
                              

© 1998-2020Legal notice