Dataset for protein classical BH3-containing proteins of organism Esox lucius

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                           .            :*    :   . . .    .    
----f----t---vgdipenine-------g-t------frntstntsqr-----mlPgv-rlrlysrsqvfstvgtsss
mfma-kmdh-qdc----e---k-kysldhl-t-hypkfqdcpsqcegnnqsrlgitm tnslvgfqpepplcrqtsrqdn
 ensstpsnrssgtttv-gtv-ipedypwhtasssseys-ygq gp tslllgsln  c-g idqn   lfygns grrh
  di riqd eness lidrkf gd hccg   rei lewieg  k ga ag nd    e     d      a a fel 
             me e  dg                    a                                      

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   .::           :         .      . .                                       * :*
--tefqcdstptspslrnakpfrtrsqsappalwaarr-------------------------------------yGqqL
gyfsldvamigseelggdnastqgphpqsqvithvmkklskpqdtwrgyeawptphhpyrprpppiagdmrpeili ce 
fpgq egvgq lpqvrtqgvrggve   ql qqp   p                                       rk 
  a    l d gncqape l   m             c                                          
                                                                                

       170       180       190       200       210       220       230      
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:.
. :.*:*                         .       :                                   
rrmsDeFdtwldk-------gepkrgkipgrakqv--yrlww--------sflwspke-eg---------------
qlig q nnlfihgrlgarn-qvhqviyhvnhrnpttspgyfgllisrllt-------a--rdtpnwriteprsse
       h-----        vsglsnsarmqqlm arls qrph gik qlifrrravatgkragli        
                      macqlm ql hel  fkp m  a ca  ai  eqe t  eg             
                      e  a l  a   i                    h                    
© 1998-2020Legal notice