Dataset for protein classical BH3-containing proteins of organism Esox lucius

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8XIA2_BCL2L11      MFDSSRPQNRSNGTTTLIGRGKIGESHPCGGATSSSKLSDYPQSCEGNQQ
A0A3P8XIA2_BCL2L11      ----------------------------------------RESSCEGNQQ
A0A3P8ZIE7_BMF-01       -------------MEDEEDDVFEPDSYCWHTASREIKYEDRGTQTPTTAL
A0A3P8Y761_BAD-01       MENIFTISDTESESSDVEETKKE----------------WIAGQGKTGSR
A0A3P9A5G8_BAD-01       --MAFKMDHTQDCVGDIPENINEKYDLDHLGTTHYPEFQFCNTSTNTSNR
A0A3P9A5G8_BAD-02       --MAFKMDHTQDCVGDIPENINEKYDLDHLGTTHYPEFQFCNTSTNTSNR
                                                                   .      

A0A3P8XIA2_BCL2L11      SRGGIMMPTNSLLGFQSRSPLFRTTSTSSSGYFSFDCDSIPSSPLLRNNK
A0A3P8XIA2_BCL2L11      SRGGIMMPTNSLLGFQSRSPLFRTTSTSSSGYFSFDCDSIPSSPLLRNNK
A0A3P8ZIE7_BMF-01       ALLNDMLPC--RLDQDPRPLFYGNAGFRLHFPAQFECVGDPGPQQRPQAV
A0A3P8Y761_BAD-01       LGLSLNLPGEGRIRLNSESQVFATSGGERS--GELQGLGQGLNCVATEGL
A0A3P9A5G8_BAD-01       -----TLPGV-RVRLYSESQVCSQVGRQDN--TEFQVAMTPTEESGGDAA
A0A3P9A5G8_BAD-02       -----TLPGV-RVRLYSESQVCSQVGRQDN--TEFQVAMTPTEESGGDAA
                              :*    :   . . .    .       .::           :  

A0A3P8XIA2_BCL2L11      STQTPSPSSQVITHAMRRLSKPQDTWRGYEAWPTPHHPYRPRPPPIAGDM
A0A3P8XIA2_BCL2L11      STQTPSPSSQVITHAMRP-----------------------------GDM
A0A3P8ZIE7_BMF-01       RGGMEHPQQLPQQPVARC--------------------------------
A0A3P8Y761_BAD-01       PFRVRSQSAPPALWAAKR--------------------------------
A0A3P9A5G8_BAD-01       PFRGRSQSAPPALWAAKK--------------------------------
A0A3P9A5G8_BAD-02       PFRGRSQSAPPALWAAKK--------------------------------
                               .      . .                                 

A0A3P8XIA2_BCL2L11      RPEILIGQELQRIGDEFNNLFIHGRLGARNGQVAQANLPQMHQEP-AFLL
A0A3P8XIA2_BCL2L11      RPEILIGQELQRIGDEFNNLFIH-------GVSGCSKMPVLHHLI--YKP
A0A3P8ZIE7_BMF-01       -----IGQKLQLIGDQFH-------------EEHLQLYHRNQRNL--RPL
A0A3P8Y761_BAD-01       -----YGRQLRRMSDEFDTWLDK-------GQMKRVKSAGAAKQMTTSPS
A0A3P9A5G8_BAD-01       -----YGCQLRRMSDEFDTWLDK-------GEPKRGIIPGRAKQV--YRG
A0A3P9A5G8_BAD-02       -----YGCQLRRMSDEFDTWLDK-------GEPKRGIIPGRAKQV--YRG
                              * :*. :.*:*                         .       

A0A3P8XIA2_BCL2L11      WMGLLIGRLLQIIWRRR-------------------
A0A3P8XIA2_BCL2L11      YQGPH-CIKLS-------------------------
A0A3P8ZIE7_BMF-01       WWRLA-SALLTLLWEQEAVAGGGRAGWR--------
A0A3P8Y761_BAD-01       WW--------AFLFSHKETETEKTPNLIITEPRSSE
A0A3P9A5G8_BAD-01       WF--------SFLWSPKEAEGRD-------------
A0A3P9A5G8_BAD-02       WF--------SFLWSPKEAEGRD-------------
                        :                                   

© 1998-2020Legal notice