Dataset for protein classical BH3-containing proteins of organism Esox lucius

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8XIA2_BCL2L11      --------MFDSSRPQNRSNGTTTLIGRGKIGESHPCGGATSSSKLSDYP
A0A3P8Y761_BAD-02       ---MGCSTPYRNGISTSTILPHTTGTGDRLLPYGLFCLITIG---TRDGT
A0A3P8YI30_BAD-01       MFYSFCHSP-----CDECFLTICNAFGQCLLRMDVFSLQAFKMDHTQDCV
A0A3P8ZIE7_BMF-01       -------------------------------------------------M
A0A3P8Y761_BAD-01       ------------------------------------MENIFTISDTESES
A0A3P8YI30_BAD-02       --------------------------------------MAFKMDHTQDCV
                                                                          

A0A3P8XIA2_BCL2L11      QSCEGNQQSRGGIMMPTNSLLGFQSRSPLFRTTSTSSSGYFSFDCDSIPS
A0A3P8Y761_BAD-02       GA--------YGL-----FWLRNTHIHPLILCSFFIGEG-----------
A0A3P8YI30_BAD-01       GDIPENINEKYDL-----DHLGTTHYPEFQFCNTSTNTSNR-----TLPG
A0A3P8ZIE7_BMF-01       EDEEDDVFEPDSY-----CWHTASREIKYEDRGTQTPTTALALLNDMLPC
A0A3P8Y761_BAD-01       SDVEETKKE---------------------WIAGQGKTGSRLGLSLNLPG
A0A3P8YI30_BAD-02       GDIPENINEKYDL-----DHLGTTHYPEFQFCNTSTNTSNR-----TLPG
                                                                          

A0A3P8XIA2_BCL2L11      SPLLRNNKSTQTPSPSSQVIT--HAMRRLSKPQDTWRGYEAWPTPHHPYR
A0A3P8Y761_BAD-02       --RIRLNSESQVFATSGGERS--GELQGLGQGLNCVATEGL------PFR
A0A3P8YI30_BAD-01       V-RVRLYSESQVCSQVGRQDN--TEFQVAMTPTEESGGDAA------PFR
A0A3P8ZIE7_BMF-01       --RLDQDPRPLFYGNAGFRLHFPAQFECVGDPGPQQRPQAV------RGG
A0A3P8Y761_BAD-01       EGRIRLNSESQVFATSGGERS--GELQGLGQGLNCVATEGL------PFR
A0A3P8YI30_BAD-02       V-RVRLYSESQVCSQVGRQDN--TEFQVAMTPTEESGGDAA------PFR
                           :     .   .  .        :                        

A0A3P8XIA2_BCL2L11      PRPPPIAGDMRPEILIGQELQRIGDEFNNLFIHGRLGARNGQVAQANLPQ
A0A3P8Y761_BAD-02       VRSQSAPPALWAAKRYGRQLRRMSDEFDTWLDKGQM---KRVKSAGAAKQ
A0A3P8YI30_BAD-01       GRSQSAPPALWAAKKYGCQLRRMSDEFDTWLDKGEP---KRGIIPGRAKQ
A0A3P8ZIE7_BMF-01       MEHPQQLPQQPVARCIGQKLQLIGDQFH------EE---HLQLYHRNQRN
A0A3P8Y761_BAD-01       VRSQSAPPALWAAKRYGRQLRRMSDEFDTWLDKGQM---KRVKSAGAAKQ
A0A3P8YI30_BAD-02       GRSQSAPPALWAAKKYGCQLRRMSDEFDTWLDKGEP---KRGIIPGRAKQ
                                        * :*. :.*:*            :         :

A0A3P8XIA2_BCL2L11      MHQEPAFLLWMGLLIGRLLQIIWRRR-------------------
A0A3P8Y761_BAD-02       MTTSPSWW-----------AFLFSHKETETEKTPNLIITEPRSSE
A0A3P8YI30_BAD-01       V--YRGWF-----------SFLWSPKEAEGRD-------------
A0A3P8ZIE7_BMF-01       L--RPLWW----RLASALLTLLWEQEAVAGGGRAGWR--------
A0A3P8Y761_BAD-01       MTTSPSWW-----------AFLFSHKETETEKTPNLIITEPRSSE
A0A3P8YI30_BAD-02       V--YRGWF-----------SFLWSPKEAEGRD-------------
                        :     :             :::                      

© 1998-2022Legal notice