Dataset for protein Bim of organism Erpetoichthys calabaricus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MARPPSDLNSESGAGDGGPLQPTQEAGRPLSRPGPRTHSEGDQSGEVSQPAPNSLQGGLAMPPSPHPYASRFPLFSYFSR
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
SSSGYYSFESGSVSSLPSMTDKFTQTPSLSSQAIRHAQQWLAQEYEHYQGHDMPQASSGPTRARRSSMPEEMRPEEMVAQ
                                                                                

       170       180       190       200       210    
....:....|....:....|....:....|....:....|....:....|....
****************      *   *. *:....  *::    .::       
ELRRIGDDFNNLYFQR------GsvwRrnGtscsr-rWvvvfvwrml-------
                varayp igg na aeagqlg lihcraqlfdiltrwr
© 1998-2022Legal notice