Dataset for protein Bim of organism Erpetoichthys calabaricus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C4REW7_BCL2L11      MARPPSDLNSESGAGDGGPLQPTQEAGRPLSRPGPRTHSEGDQSGEVSQP
A0A8C4REW7_BCL2L11      MARPPSDLNSESGAGDGGPLQPTQEAGRPLSRPGPRTHSEGDQSGEVSQP
                        **************************************************

A0A8C4REW7_BCL2L11      APNSLQGGLAMPPSPHPYASRFPLFSYFSRSSSGYYSFESGSVSSLPSMT
A0A8C4REW7_BCL2L11      APNSLQGGLAMPPSPHPYASRFPLFSYFSRSSSGYYSFESGSVSSLPSMT
                        **************************************************

A0A8C4REW7_BCL2L11      DKFTQTPSLSSQAIRHAQQWLAQEYEHYQGHDMPQASSGPTRARRSSMPE
A0A8C4REW7_BCL2L11      DKFTQTPSLSSQAIRHAQQWLAQEYEHYQGHDMPQASSGPTRARRSSMPE
                        **************************************************

A0A8C4REW7_BCL2L11      EMRPEEMVAQELRRIGDDFNNLYFQRVARAYPGSVWRRAGTSCGQ-GWLV
A0A8C4REW7_BCL2L11      EMRPEEMVAQELRRIGDDFNNLYFQR------GIGGRNNGAEASRLRWVI
                        **************************      *   *. *:....  *::

A0A8C4REW7_BCL2L11      HCRAQML-------
A0A8C4REW7_BCL2L11      VFVWRLFDILTRWR
                            .::       

© 1998-2022Legal notice