Dataset for protein Bim of organism Erpetoichthys calabaricus

[Download (right click)] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A8C4REW7_BCL2L11-01      MARPPSDLNSESGAGDGGPLQPTQEAGRPLSRPGPRTHSEGDQSGEVSQP
A0A8C4REW7_BCL2L11-02      MARPPSDLNSESGAGDGGPLQPTQEAGRPLSRPGPRTHSEGDQSGEVSQP
                           **************************************************

A0A8C4REW7_BCL2L11-01      APNSLQGGLAMPPSPHPYASRFPLFSYFSRSSSGYYSFESGSVSSLPSMT
A0A8C4REW7_BCL2L11-02      APNSLQGGLAMPPSPHPYASRFPLFSYFSRSSSGYYSFESGSVSSLPSMT
                           **************************************************

A0A8C4REW7_BCL2L11-01      DKFTQTPSLSSQAIRHAQQWLAQEYEHYQGHDMPQASSGPTRARRSSMPE
A0A8C4REW7_BCL2L11-02      DKFTQTPSLSSQAIRHAQQWLAQEYEHYQGHDMPQASSGPTRARRSSMPE
                           **************************************************

A0A8C4REW7_BCL2L11-01      EMRPEEMVAQELRRIGDDFNNLYFQRGIGGRNNGAEASRLRWVIVFVWRL
A0A8C4REW7_BCL2L11-02      EMRPEEMVAQELRRIGDDFNNLYFQRVARA-YPGSVWRRAGTSCGQGW-L
                           **************************   .   *:   *        * *

A0A8C4REW7_BCL2L11-01      FDILTRWR
A0A8C4REW7_BCL2L11-02      VHCRAQML
                           ..  ::  

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice