Dataset for protein Bad of organism Erpetoichthys calabaricus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         ***********************************************************************
---------MAKMFSLSDSESDISDDVIQDGDSSGREVRNASSVKQSRTMPSIKMSDVEGRIRGVSESQASEAEMDDELT
mssiltdav                                                                       

        90       100       110       120       130       140       150  
....:....|....:....|....:....|....:....|....:....|....:....|....:....|..
************************************************************************
SFRNRSHSAPPALWAARRYGRELRRMSDEFGISHGEFKRAKSAGTAKQMTTSTSWWTFLWSKRQQSESSKAN
                                                                        
© 1998-2022Legal notice