Dataset for protein Bad of organism Erpetoichthys calabaricus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C4SET9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Erpetoichthys calabaricus GN=BAD (length=143 residues).
MAKMFSLSDSESDISDDVIQDGDSSGREVRNASSVKQSRTMPSIKMSDVEGRIRGVSESQASEAEMDDELTSFRNRSHSA
PPALWAARRYGRELRRMSDEFGISHGEFKRAKSAGTAKQMTTSTSWWTFLWSKRQQSESSKAN
>gnl|bcl2dbpro|A0A8C4SET9_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Erpetoichthys calabaricus GN=BAD (length=152 residues).
MSSILTDAVMAKMFSLSDSESDISDDVIQDGDSSGREVRNASSVKQSRTMPSIKMSDVEGRIRGVSESQASEAEMDDELT
SFRNRSHSAPPALWAARRYGRELRRMSDEFGISHGEFKRAKSAGTAKQMTTSTSWWTFLWSKRQQSESSKAN
© 1998-2022Legal notice